BLASTX nr result
ID: Ophiopogon24_contig00005133
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00005133 (408 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_016466254.1| PREDICTED: H/ACA ribonucleoprotein complex s... 50 2e-09 ref|XP_009608322.1| PREDICTED: H/ACA ribonucleoprotein complex s... 50 2e-09 ref|XP_019462551.1| PREDICTED: H/ACA ribonucleoprotein complex s... 49 3e-09 ref|XP_009800512.1| PREDICTED: H/ACA ribonucleoprotein complex s... 50 3e-09 ref|XP_009602197.1| PREDICTED: H/ACA ribonucleoprotein complex s... 50 3e-09 ref|XP_008802167.1| PREDICTED: H/ACA ribonucleoprotein complex s... 48 4e-09 ref|XP_016566455.1| PREDICTED: H/ACA ribonucleoprotein complex s... 50 7e-09 ref|XP_006365894.1| PREDICTED: H/ACA ribonucleoprotein complex s... 50 7e-09 gb|PON62651.1| H/ACA ribonucleoprotein complex, subunit Nop [Par... 49 7e-09 gb|OIW19362.1| hypothetical protein TanjilG_03496 [Lupinus angus... 49 7e-09 gb|PON81757.1| H/ACA ribonucleoprotein complex, subunit Nop [Tre... 49 9e-09 ref|XP_023733500.1| H/ACA ribonucleoprotein complex subunit 3-li... 49 9e-09 ref|XP_021982227.1| H/ACA ribonucleoprotein complex subunit 3-li... 49 9e-09 gb|OIV99730.1| hypothetical protein TanjilG_26068 [Lupinus angus... 49 9e-09 ref|XP_021632290.1| H/ACA ribonucleoprotein complex subunit 3-li... 49 9e-09 gb|OAY32653.1| hypothetical protein MANES_13G035400 [Manihot esc... 49 9e-09 ref|XP_002529850.1| PREDICTED: H/ACA ribonucleoprotein complex s... 49 9e-09 emb|CDP18800.1| unnamed protein product [Coffea canephora] 48 1e-08 gb|KCW88531.1| hypothetical protein EUGRSUZ_A00909, partial [Euc... 49 1e-08 dbj|GAV80150.1| Nop10p domain-containing protein [Cephalotus fol... 48 1e-08 >ref|XP_016466254.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein [Nicotiana tabacum] Length = 87 Score = 50.4 bits (119), Expect(2) = 2e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +1 Query: 160 SRQRVLLKKRFGLLPTQKPPQKY 228 SRQRVLLKKRFGLLPTQKPPQKY Sbjct: 65 SRQRVLLKKRFGLLPTQKPPQKY 87 Score = 39.3 bits (90), Expect(2) = 2e-09 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +2 Query: 86 KPSTMYLQFYINENGDKVYT 145 K + MYLQFYINENGDKVYT Sbjct: 20 KLARMYLQFYINENGDKVYT 39 >ref|XP_009608322.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein isoform X2 [Nicotiana tomentosiformis] Length = 87 Score = 50.4 bits (119), Expect(2) = 2e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +1 Query: 160 SRQRVLLKKRFGLLPTQKPPQKY 228 SRQRVLLKKRFGLLPTQKPPQKY Sbjct: 65 SRQRVLLKKRFGLLPTQKPPQKY 87 Score = 39.3 bits (90), Expect(2) = 2e-09 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +2 Query: 86 KPSTMYLQFYINENGDKVYT 145 K + MYLQFYINENGDKVYT Sbjct: 20 KLARMYLQFYINENGDKVYT 39 >ref|XP_019462551.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein [Lupinus angustifolius] Length = 126 Score = 48.9 bits (115), Expect(2) = 3e-09 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +1 Query: 160 SRQRVLLKKRFGLLPTQKPPQKY 228 SRQRVLLKKRFGLLPTQ+PPQKY Sbjct: 104 SRQRVLLKKRFGLLPTQQPPQKY 126 Score = 40.0 bits (92), Expect(2) = 3e-09 Identities = 24/47 (51%), Positives = 29/47 (61%) Frame = +2 Query: 5 FLAKSLEP*PPQRRAKVVGGALEFGDSKPSTMYLQFYINENGDKVYT 145 F++ SL P+ A VV A+ TMYLQFYIN+NGDKVYT Sbjct: 40 FISLSLFTFLPRLAAIVVHSAV--------TMYLQFYINDNGDKVYT 78 >ref|XP_009800512.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein [Nicotiana sylvestris] ref|XP_016480213.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein [Nicotiana tabacum] ref|XP_019250037.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein [Nicotiana attenuata] Length = 64 Score = 50.4 bits (119), Expect(2) = 3e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +1 Query: 160 SRQRVLLKKRFGLLPTQKPPQKY 228 SRQRVLLKKRFGLLPTQKPPQKY Sbjct: 42 SRQRVLLKKRFGLLPTQKPPQKY 64 Score = 38.5 bits (88), Expect(2) = 3e-09 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 98 MYLQFYINENGDKVYT 145 MYLQFYINENGDKVYT Sbjct: 1 MYLQFYINENGDKVYT 16 >ref|XP_009602197.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein [Nicotiana tomentosiformis] ref|XP_009779380.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein [Nicotiana sylvestris] ref|XP_016432288.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein [Nicotiana tabacum] ref|XP_018626742.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein [Nicotiana tomentosiformis] Length = 64 Score = 50.4 bits (119), Expect(2) = 3e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +1 Query: 160 SRQRVLLKKRFGLLPTQKPPQKY 228 SRQRVLLKKRFGLLPTQKPPQKY Sbjct: 42 SRQRVLLKKRFGLLPTQKPPQKY 64 Score = 38.5 bits (88), Expect(2) = 3e-09 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 98 MYLQFYINENGDKVYT 145 MYLQFYINENGDKVYT Sbjct: 1 MYLQFYINENGDKVYT 16 >ref|XP_008802167.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein isoform X2 [Phoenix dactylifera] Length = 63 Score = 48.1 bits (113), Expect(2) = 4e-09 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 160 SRQRVLLKKRFGLLPTQKPPQKY 228 SRQRVLLKKRFGLLPTQKPP KY Sbjct: 41 SRQRVLLKKRFGLLPTQKPPPKY 63 Score = 40.4 bits (93), Expect(2) = 4e-09 Identities = 18/23 (78%), Positives = 18/23 (78%) Frame = +2 Query: 98 MYLQFYINENGDKVYTXXXXTLG 166 MYLQFYINENGDKVYT LG Sbjct: 1 MYLQFYINENGDKVYTTKESPLG 23 >ref|XP_016566455.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein [Capsicum annuum] ref|XP_016572119.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein [Capsicum annuum] gb|PHT27858.1| H/ACA ribonucleoprotein complex subunit 3 [Capsicum baccatum] gb|PHT54274.1| H/ACA ribonucleoprotein complex subunit 3 [Capsicum baccatum] gb|PHT80847.1| H/ACA ribonucleoprotein complex subunit 3 [Capsicum annuum] gb|PHT85515.1| H/ACA ribonucleoprotein complex subunit 3 [Capsicum annuum] gb|PHU16957.1| H/ACA ribonucleoprotein complex subunit 3 [Capsicum chinense] gb|PHU21474.1| H/ACA ribonucleoprotein complex subunit 3 [Capsicum chinense] Length = 64 Score = 50.4 bits (119), Expect(2) = 7e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +1 Query: 160 SRQRVLLKKRFGLLPTQKPPQKY 228 SRQRVLLKKRFGLLPTQKPPQKY Sbjct: 42 SRQRVLLKKRFGLLPTQKPPQKY 64 Score = 37.4 bits (85), Expect(2) = 7e-09 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 98 MYLQFYINENGDKVYT 145 MYLQFYIN+NGDKVYT Sbjct: 1 MYLQFYINDNGDKVYT 16 >ref|XP_006365894.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein [Solanum tuberosum] Length = 64 Score = 50.4 bits (119), Expect(2) = 7e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +1 Query: 160 SRQRVLLKKRFGLLPTQKPPQKY 228 SRQRVLLKKRFGLLPTQKPPQKY Sbjct: 42 SRQRVLLKKRFGLLPTQKPPQKY 64 Score = 37.4 bits (85), Expect(2) = 7e-09 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 98 MYLQFYINENGDKVYT 145 MYLQFYIN+NGDKVYT Sbjct: 1 MYLQFYINDNGDKVYT 16 >gb|PON62651.1| H/ACA ribonucleoprotein complex, subunit Nop [Parasponia andersonii] Length = 64 Score = 48.9 bits (115), Expect(2) = 7e-09 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +1 Query: 160 SRQRVLLKKRFGLLPTQKPPQKY 228 SRQRVLLKKRFGLLPTQ+PPQKY Sbjct: 42 SRQRVLLKKRFGLLPTQQPPQKY 64 Score = 38.9 bits (89), Expect(2) = 7e-09 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = +2 Query: 98 MYLQFYINENGDKVYTXXXXT 160 MYLQFYINENGDKVYT T Sbjct: 1 MYLQFYINENGDKVYTTKKET 21 >gb|OIW19362.1| hypothetical protein TanjilG_03496 [Lupinus angustifolius] Length = 64 Score = 48.9 bits (115), Expect(2) = 7e-09 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +1 Query: 160 SRQRVLLKKRFGLLPTQKPPQKY 228 SRQRVLLKKRFGLLPTQ+PPQKY Sbjct: 42 SRQRVLLKKRFGLLPTQQPPQKY 64 Score = 38.9 bits (89), Expect(2) = 7e-09 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = +2 Query: 98 MYLQFYINENGDKVYTXXXXT 160 MYLQFYINENGDKVYT T Sbjct: 1 MYLQFYINENGDKVYTTKKET 21 >gb|PON81757.1| H/ACA ribonucleoprotein complex, subunit Nop [Trema orientalis] Length = 64 Score = 48.9 bits (115), Expect(2) = 9e-09 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +1 Query: 160 SRQRVLLKKRFGLLPTQKPPQKY 228 SRQRVLLKKRFGLLPTQ+PPQKY Sbjct: 42 SRQRVLLKKRFGLLPTQQPPQKY 64 Score = 38.5 bits (88), Expect(2) = 9e-09 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 98 MYLQFYINENGDKVYT 145 MYLQFYINENGDKVYT Sbjct: 1 MYLQFYINENGDKVYT 16 >ref|XP_023733500.1| H/ACA ribonucleoprotein complex subunit 3-like protein [Lactuca sativa] gb|PLY74171.1| hypothetical protein LSAT_9X10421 [Lactuca sativa] Length = 64 Score = 48.9 bits (115), Expect(2) = 9e-09 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +1 Query: 160 SRQRVLLKKRFGLLPTQKPPQKY 228 SRQRVLLKKRFGLLPTQKPP+KY Sbjct: 42 SRQRVLLKKRFGLLPTQKPPRKY 64 Score = 38.5 bits (88), Expect(2) = 9e-09 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 98 MYLQFYINENGDKVYT 145 MYLQFYINENGDKVYT Sbjct: 1 MYLQFYINENGDKVYT 16 >ref|XP_021982227.1| H/ACA ribonucleoprotein complex subunit 3-like protein [Helianthus annuus] gb|OTG14878.1| putative nucleolar RNA-binding Nop10p family protein [Helianthus annuus] Length = 64 Score = 48.9 bits (115), Expect(2) = 9e-09 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +1 Query: 160 SRQRVLLKKRFGLLPTQKPPQKY 228 SRQRVLLKKRFGLLPTQKPP+KY Sbjct: 42 SRQRVLLKKRFGLLPTQKPPRKY 64 Score = 38.5 bits (88), Expect(2) = 9e-09 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 98 MYLQFYINENGDKVYT 145 MYLQFYINENGDKVYT Sbjct: 1 MYLQFYINENGDKVYT 16 >gb|OIV99730.1| hypothetical protein TanjilG_26068 [Lupinus angustifolius] Length = 64 Score = 48.9 bits (115), Expect(2) = 9e-09 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +1 Query: 160 SRQRVLLKKRFGLLPTQKPPQKY 228 SRQRVLLKKRFGLLPTQ+PPQKY Sbjct: 42 SRQRVLLKKRFGLLPTQQPPQKY 64 Score = 38.5 bits (88), Expect(2) = 9e-09 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 98 MYLQFYINENGDKVYT 145 MYLQFYINENGDKVYT Sbjct: 1 MYLQFYINENGDKVYT 16 >ref|XP_021632290.1| H/ACA ribonucleoprotein complex subunit 3-like protein [Manihot esculenta] ref|XP_021632291.1| H/ACA ribonucleoprotein complex subunit 3-like protein [Manihot esculenta] gb|OAY32655.1| hypothetical protein MANES_13G035600 [Manihot esculenta] Length = 64 Score = 48.9 bits (115), Expect(2) = 9e-09 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +1 Query: 160 SRQRVLLKKRFGLLPTQKPPQKY 228 SRQRVLLKKRFGLLPTQ+PPQKY Sbjct: 42 SRQRVLLKKRFGLLPTQQPPQKY 64 Score = 38.5 bits (88), Expect(2) = 9e-09 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 98 MYLQFYINENGDKVYT 145 MYLQFYINENGDKVYT Sbjct: 1 MYLQFYINENGDKVYT 16 >gb|OAY32653.1| hypothetical protein MANES_13G035400 [Manihot esculenta] Length = 64 Score = 48.9 bits (115), Expect(2) = 9e-09 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +1 Query: 160 SRQRVLLKKRFGLLPTQKPPQKY 228 SRQRVLLKKRFGLLPTQ+PPQKY Sbjct: 42 SRQRVLLKKRFGLLPTQQPPQKY 64 Score = 38.5 bits (88), Expect(2) = 9e-09 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 98 MYLQFYINENGDKVYT 145 MYLQFYINENGDKVYT Sbjct: 1 MYLQFYINENGDKVYT 16 >ref|XP_002529850.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein [Ricinus communis] gb|EEF32551.1| ribosome biogenesis protein nop10, putative [Ricinus communis] Length = 64 Score = 48.9 bits (115), Expect(2) = 9e-09 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +1 Query: 160 SRQRVLLKKRFGLLPTQKPPQKY 228 SRQRVLLKKRFGLLPTQ+PPQKY Sbjct: 42 SRQRVLLKKRFGLLPTQQPPQKY 64 Score = 38.5 bits (88), Expect(2) = 9e-09 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 98 MYLQFYINENGDKVYT 145 MYLQFYINENGDKVYT Sbjct: 1 MYLQFYINENGDKVYT 16 >emb|CDP18800.1| unnamed protein product [Coffea canephora] Length = 204 Score = 48.1 bits (113), Expect(2) = 1e-08 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 160 SRQRVLLKKRFGLLPTQKPPQKY 228 SRQRVLLKKRFGLLPTQKPP KY Sbjct: 182 SRQRVLLKKRFGLLPTQKPPPKY 204 Score = 38.9 bits (89), Expect(2) = 1e-08 Identities = 16/21 (76%), Positives = 19/21 (90%) Frame = +2 Query: 83 SKPSTMYLQFYINENGDKVYT 145 ++ S M+LQFYINENGDKVYT Sbjct: 136 TRDSEMFLQFYINENGDKVYT 156 >gb|KCW88531.1| hypothetical protein EUGRSUZ_A00909, partial [Eucalyptus grandis] Length = 95 Score = 48.9 bits (115), Expect(2) = 1e-08 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +1 Query: 160 SRQRVLLKKRFGLLPTQKPPQKY 228 SRQRVLLKKRFGLLPTQ+PPQKY Sbjct: 73 SRQRVLLKKRFGLLPTQQPPQKY 95 Score = 37.7 bits (86), Expect(2) = 1e-08 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = +2 Query: 92 STMYLQFYINENGDKVYT 145 + MYLQFYIN+NGDKVYT Sbjct: 30 AAMYLQFYINDNGDKVYT 47 >dbj|GAV80150.1| Nop10p domain-containing protein [Cephalotus follicularis] Length = 64 Score = 48.1 bits (113), Expect(2) = 1e-08 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 160 SRQRVLLKKRFGLLPTQKPPQKY 228 SRQRVLLKKRFGLLPTQKPP KY Sbjct: 42 SRQRVLLKKRFGLLPTQKPPPKY 64 Score = 38.5 bits (88), Expect(2) = 1e-08 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 98 MYLQFYINENGDKVYT 145 MYLQFYINENGDKVYT Sbjct: 1 MYLQFYINENGDKVYT 16