BLASTX nr result
ID: Ophiopogon24_contig00004982
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00004982 (396 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020273283.1| LOW QUALITY PROTEIN: cytoplasmic tRNA 2-thio... 64 4e-09 ref|XP_010906284.1| PREDICTED: cytoplasmic tRNA 2-thiolation pro... 56 2e-06 >ref|XP_020273283.1| LOW QUALITY PROTEIN: cytoplasmic tRNA 2-thiolation protein 2 [Asparagus officinalis] Length = 454 Score = 63.5 bits (153), Expect = 4e-09 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +3 Query: 6 ETVSLEHFFSLLPGSMTDRVKGSKCADHSRLREQIKDCLLS 128 E+ SLEHF+SLLPGSMT+RVK S AD+S LREQIKDCLLS Sbjct: 408 ESNSLEHFYSLLPGSMTNRVKDSTHADNSCLREQIKDCLLS 448 >ref|XP_010906284.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 2 [Elaeis guineensis] Length = 468 Score = 56.2 bits (134), Expect = 2e-06 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = +3 Query: 15 SLEHFFSLLPGSMTDRVKGSKCADHSRLREQIKDCLLSXXXXXXGT 152 SLEHF+S+LP MT+R+K S C D S+LR+QI+DCLL+ GT Sbjct: 423 SLEHFYSVLPQLMTERMKDSLCFDRSQLRDQIEDCLLADDDDDDGT 468