BLASTX nr result
ID: Ophiopogon24_contig00004876
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00004876 (821 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020267898.1| cytochrome b561 and DOMON domain-containing ... 54 2e-10 ref|XP_008803564.2| PREDICTED: cytochrome b561 and DOMON domain-... 49 2e-06 >ref|XP_020267898.1| cytochrome b561 and DOMON domain-containing protein At3g25290-like [Asparagus officinalis] gb|ONK69896.1| uncharacterized protein A4U43_C05F27980 [Asparagus officinalis] Length = 259 Score = 53.9 bits (128), Expect(2) = 2e-10 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 520 KYGSIYHRSLGYAVVALVIVNIFKGLAILRP 612 KY IYH SLGYA+VAL +VNIFKGLAILRP Sbjct: 182 KYWRIYHHSLGYALVALAVVNIFKGLAILRP 212 Score = 40.8 bits (94), Expect(2) = 2e-10 Identities = 21/47 (44%), Positives = 29/47 (61%) Frame = +2 Query: 614 PVSWKRANVRILTGLSFVALLLEIAT*VQFCWEVHHKDKSKA*SKTG 754 P +WK + IL GL+ VAL LEI T V+F W +D+S+ S+ G Sbjct: 213 PATWKWVCIGILIGLACVALFLEITTWVKFYWPAQLEDESQNQSQPG 259 >ref|XP_008803564.2| PREDICTED: cytochrome b561 and DOMON domain-containing protein At3g25290-like [Phoenix dactylifera] Length = 400 Score = 48.5 bits (114), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 27/31 (87%) Frame = +1 Query: 520 KYGSIYHRSLGYAVVALVIVNIFKGLAILRP 612 KY +IYH +GY+++AL+IVNIFKG AIL+P Sbjct: 320 KYWNIYHHFVGYSLIALIIVNIFKGFAILKP 350 Score = 32.3 bits (72), Expect(2) = 2e-06 Identities = 21/47 (44%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = +2 Query: 614 PVSWKRANVRILTGLSFVALLLEIAT*VQFCW-EVHHKDKSKA*SKT 751 P WK A + IL LS VAL LEI+ V+F W + + K+ SKT Sbjct: 351 PSGWKWAYIGILISLSCVALGLEISIWVKFYWNQKAEQQKASNLSKT 397