BLASTX nr result
ID: Ophiopogon24_contig00004820
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00004820 (566 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020247799.1| protein MULTIPLE CHLOROPLAST DIVISION SITE 1... 76 5e-13 >ref|XP_020247799.1| protein MULTIPLE CHLOROPLAST DIVISION SITE 1 [Asparagus officinalis] Length = 333 Score = 76.3 bits (186), Expect = 5e-13 Identities = 39/62 (62%), Positives = 47/62 (75%) Frame = +3 Query: 3 NEVTINLRSIQGSEGAVGPSSKPREQTEPIPSTNQQYNHMTTNANSEAGSNESMLEDEMK 182 NEVTIN+RSIQGSEGAV S K + Q +P ST+QQY HM +N N+E GS E++L DEMK Sbjct: 272 NEVTINVRSIQGSEGAVS-SQKSKPQEQPSSSTDQQYKHMPSNPNTEDGSGENLLPDEMK 330 Query: 183 TK 188 K Sbjct: 331 RK 332