BLASTX nr result
ID: Ophiopogon24_contig00004674
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00004674 (406 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020246241.1| rhodanese-like domain-containing protein 11,... 60 8e-08 gb|ONK58343.1| uncharacterized protein A4U43_C09F11230 [Asparagu... 60 9e-08 ref|XP_018505918.1| PREDICTED: rhodanese-like domain-containing ... 52 7e-06 >ref|XP_020246241.1| rhodanese-like domain-containing protein 11, chloroplastic isoform X1 [Asparagus officinalis] ref|XP_020246242.1| rhodanese-like domain-containing protein 11, chloroplastic isoform X2 [Asparagus officinalis] Length = 286 Score = 59.7 bits (143), Expect = 8e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 3 YRLVFTGRLIGAIVLADALFFGAQQFGPYFKK 98 YRLVFTGRLIGAIVLADALFFGAQQFGP ++ Sbjct: 251 YRLVFTGRLIGAIVLADALFFGAQQFGPLLRE 282 >gb|ONK58343.1| uncharacterized protein A4U43_C09F11230 [Asparagus officinalis] Length = 310 Score = 59.7 bits (143), Expect = 9e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 3 YRLVFTGRLIGAIVLADALFFGAQQFGPYFKK 98 YRLVFTGRLIGAIVLADALFFGAQQFGP ++ Sbjct: 215 YRLVFTGRLIGAIVLADALFFGAQQFGPLLRE 246 >ref|XP_018505918.1| PREDICTED: rhodanese-like domain-containing protein 11, chloroplastic, partial [Pyrus x bretschneideri] Length = 134 Score = 52.4 bits (124), Expect = 7e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +3 Query: 3 YRLVFTGRLIGAIVLADALFFGAQQFGPYFK 95 YRLVF+ RL+G I+LADALFFGAQQFG Y + Sbjct: 97 YRLVFSARLVGVIILADALFFGAQQFGHYLQ 127