BLASTX nr result
ID: Ophiopogon24_contig00004255
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00004255 (420 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020263463.1| elongation factor G-1, chloroplastic, partia... 62 2e-08 >ref|XP_020263463.1| elongation factor G-1, chloroplastic, partial [Asparagus officinalis] Length = 744 Score = 62.4 bits (150), Expect = 2e-08 Identities = 40/58 (68%), Positives = 48/58 (82%), Gaps = 2/58 (3%) Frame = +2 Query: 251 LASNLRRGSEFFGGNLRLRSKSPSVPFP-REQNIHRR-SVKAMAAPEEAKRQIPLKDY 418 L S+L + S+FFG N+RLRSKS +VPF RE++ H + SVKAMAAPEEAKRQIPLKDY Sbjct: 2 LPSSLVQSSDFFG-NVRLRSKS-AVPFVLRERSGHGQGSVKAMAAPEEAKRQIPLKDY 57