BLASTX nr result
ID: Ophiopogon24_contig00004239
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00004239 (366 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_064104.1| orf110b gene product (mitochondrion) [Beta vulg... 74 2e-14 gb|KJB09734.1| hypothetical protein B456_001G161000, partial [Go... 75 7e-14 ref|YP_173477.1| hypothetical protein NitaMp140 [Nicotiana tabac... 70 4e-13 gb|OIW15497.1| hypothetical protein TanjilG_32901 [Lupinus angus... 59 2e-08 >ref|NP_064104.1| orf110b gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] ref|YP_004222346.1| hypothetical protein BevumaM_p112 (mitochondrion) [Beta vulgaris subsp. maritima] ref|YP_004842151.1| hypothetical protein BemaM_p107 (mitochondrion) [Beta macrocarpa] dbj|BAA99498.1| orf110b (mitochondrion) [Beta vulgaris subsp. vulgaris] emb|CBJ14076.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] emb|CBJ17566.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] emb|CBJ20714.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] emb|CBX24956.1| hypothetical protein (mitochondrion) [Beta macrocarpa] emb|CBL51962.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 110 Score = 73.6 bits (179), Expect = 2e-14 Identities = 36/49 (73%), Positives = 39/49 (79%) Frame = +1 Query: 1 PLRSGFEPLTQGFSVLCSNLLSYLNHFPKVSFLHL*APHQQWKSLLKNR 147 PLRSGFEPLTQGFSVLCSN LSYLNHFPKV FLH AP+ + S K + Sbjct: 45 PLRSGFEPLTQGFSVLCSNQLSYLNHFPKVCFLHRIAPYTFFLSQNKEK 93 >gb|KJB09734.1| hypothetical protein B456_001G161000, partial [Gossypium raimondii] Length = 244 Score = 75.1 bits (183), Expect = 7e-14 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = +1 Query: 1 PLRSGFEPLTQGFSVLCSNLLSYLNHFPKVSFLHL*APH 117 PLRSGFEPLTQGFSVLCSN LSYLNHFPKVSFLH AP+ Sbjct: 101 PLRSGFEPLTQGFSVLCSNQLSYLNHFPKVSFLHRIAPY 139 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = +3 Query: 252 TDVVLFCLPRDSIKKRFFLSRNLARPFHFRAGGNGIRT 365 T++VLFC P DS K RFFLSRN A P FRAGGNGIRT Sbjct: 180 TEIVLFCPPGDSTK-RFFLSRNFACPLDFRAGGNGIRT 216 >ref|YP_173477.1| hypothetical protein NitaMp140 [Nicotiana tabacum] dbj|BAD83543.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 116 Score = 70.5 bits (171), Expect = 4e-13 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +1 Query: 4 LRSGFEPLTQGFSVLCSNLLSYLNHFPKVSFLHL*APH 117 LRSGFEPLTQGFSVLCSN LSYLNHFPKV FLH AP+ Sbjct: 76 LRSGFEPLTQGFSVLCSNQLSYLNHFPKVCFLHRIAPY 113 >gb|OIW15497.1| hypothetical protein TanjilG_32901 [Lupinus angustifolius] Length = 153 Score = 59.3 bits (142), Expect = 2e-08 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 1/37 (2%) Frame = -3 Query: 364 VRIPFPPARKWNGRAKLRERKNLF-LMESLGRQNSTT 257 VRIPFP A+KWNGRAKLR+RKNL L++SLG QNSTT Sbjct: 117 VRIPFPSAQKWNGRAKLRDRKNLLVLVQSLGGQNSTT 153