BLASTX nr result
ID: Ophiopogon24_contig00003181
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00003181 (384 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK72889.1| uncharacterized protein A4U43_C04F24480, partial ... 62 9e-09 ref|XP_020261800.1| CAAX prenyl protease 1 homolog [Asparagus of... 62 9e-09 gb|PAN07584.1| hypothetical protein PAHAL_A02917 [Panicum hallii] 61 2e-08 dbj|BAS80295.1| Os02g0680400, partial [Oryza sativa Japonica Group] 60 5e-08 ref|XP_015622849.1| PREDICTED: CAAX prenyl protease 1 homolog [O... 60 6e-08 gb|EEC73787.1| hypothetical protein OsI_08473 [Oryza sativa Indi... 60 6e-08 ref|NP_001131195.1| uncharacterized protein LOC100192503 [Zea ma... 60 6e-08 ref|XP_004953446.1| CAAX prenyl protease 1 homolog [Setaria ital... 60 6e-08 ref|XP_002454476.1| CAAX prenyl protease 1 homolog [Sorghum bico... 60 6e-08 emb|CAL26913.1| CAAX peptidase [Hordeum vulgare subsp. vulgare] 60 6e-08 gb|KQL30940.1| hypothetical protein SETIT_016781mg [Setaria ital... 60 6e-08 gb|AQK54270.1| CAAX prenyl protease 1 [Zea mays] 60 7e-08 gb|AAM76469.1| putative CAAX prenyl protease, partial [Gossypium... 55 7e-08 gb|AAM76472.1| putative CAAX prenyl protease, partial [Gossypium... 55 7e-08 ref|XP_020689270.1| CAAX prenyl protease 1 homolog [Dendrobium c... 60 8e-08 gb|PKU86981.1| CAAX prenyl protease 1 like [Dendrobium catenatum] 60 8e-08 ref|XP_018681895.1| PREDICTED: CAAX prenyl protease 1 homolog is... 59 2e-07 ref|XP_009400731.1| PREDICTED: CAAX prenyl protease 1 homolog is... 59 2e-07 gb|OAY73710.1| CAAX prenyl protease [Ananas comosus] 59 2e-07 ref|XP_020094591.1| CAAX prenyl protease 1 homolog [Ananas comosus] 59 2e-07 >gb|ONK72889.1| uncharacterized protein A4U43_C04F24480, partial [Asparagus officinalis] Length = 414 Score = 62.4 bits (150), Expect = 9e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 382 TDPLYSVYHYSHPPLVERLAALDDADSKKED 290 TDPLYS YHYSHPPLVERLAALDD +SKKE+ Sbjct: 384 TDPLYSAYHYSHPPLVERLAALDDTESKKEE 414 >ref|XP_020261800.1| CAAX prenyl protease 1 homolog [Asparagus officinalis] Length = 425 Score = 62.4 bits (150), Expect = 9e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 382 TDPLYSVYHYSHPPLVERLAALDDADSKKED 290 TDPLYS YHYSHPPLVERLAALDD +SKKE+ Sbjct: 395 TDPLYSAYHYSHPPLVERLAALDDTESKKEE 425 >gb|PAN07584.1| hypothetical protein PAHAL_A02917 [Panicum hallii] Length = 425 Score = 61.2 bits (147), Expect = 2e-08 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 382 TDPLYSVYHYSHPPLVERLAALDDADSKKED 290 TDP YS YHYSHPPLVERL AL+DADSKKED Sbjct: 395 TDPWYSAYHYSHPPLVERLQALEDADSKKED 425 >dbj|BAS80295.1| Os02g0680400, partial [Oryza sativa Japonica Group] Length = 336 Score = 60.1 bits (144), Expect = 5e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 382 TDPLYSVYHYSHPPLVERLAALDDADSKKED 290 TDP YS YHYSHPPLVERL+AL+DADSKKE+ Sbjct: 306 TDPWYSAYHYSHPPLVERLSALEDADSKKEN 336 >ref|XP_015622849.1| PREDICTED: CAAX prenyl protease 1 homolog [Oryza sativa Japonica Group] sp|Q6EPN8.1|FACE1_ORYSJ RecName: Full=CAAX prenyl protease 1 homolog; AltName: Full=Farnesylated proteins-converting enzyme 1; Short=FACE-1; AltName: Full=Prenyl protein-specific endoprotease 1; AltName: Full=Zinc metalloproteinase Ste24 homolog dbj|BAD29382.1| putative Ste24p [Oryza sativa Japonica Group] dbj|BAF09653.1| Os02g0680400 [Oryza sativa Japonica Group] gb|EEE57578.1| hypothetical protein OsJ_07930 [Oryza sativa Japonica Group] dbj|BAS80294.1| Os02g0680400 [Oryza sativa Japonica Group] Length = 425 Score = 60.1 bits (144), Expect = 6e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 382 TDPLYSVYHYSHPPLVERLAALDDADSKKED 290 TDP YS YHYSHPPLVERL+AL+DADSKKE+ Sbjct: 395 TDPWYSAYHYSHPPLVERLSALEDADSKKEN 425 >gb|EEC73787.1| hypothetical protein OsI_08473 [Oryza sativa Indica Group] Length = 425 Score = 60.1 bits (144), Expect = 6e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 382 TDPLYSVYHYSHPPLVERLAALDDADSKKED 290 TDP YS YHYSHPPLVERL+AL+DADSKKE+ Sbjct: 395 TDPWYSAYHYSHPPLVERLSALEDADSKKEN 425 >ref|NP_001131195.1| uncharacterized protein LOC100192503 [Zea mays] gb|ACF79503.1| unknown [Zea mays] gb|ACG28474.1| CAAX prenyl protease 1 [Zea mays] Length = 425 Score = 60.1 bits (144), Expect = 6e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 382 TDPLYSVYHYSHPPLVERLAALDDADSKKED 290 TDP YS YHYSHPPLVERL AL+D+DSKKED Sbjct: 395 TDPWYSAYHYSHPPLVERLQALEDSDSKKED 425 >ref|XP_004953446.1| CAAX prenyl protease 1 homolog [Setaria italica] Length = 425 Score = 60.1 bits (144), Expect = 6e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 382 TDPLYSVYHYSHPPLVERLAALDDADSKKED 290 TDP YS YHYSHPPLVERL AL+D+DSKKED Sbjct: 395 TDPWYSAYHYSHPPLVERLQALEDSDSKKED 425 >ref|XP_002454476.1| CAAX prenyl protease 1 homolog [Sorghum bicolor] gb|EES07452.1| hypothetical protein SORBI_3004G282100 [Sorghum bicolor] Length = 425 Score = 60.1 bits (144), Expect = 6e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 382 TDPLYSVYHYSHPPLVERLAALDDADSKKED 290 TDP YS YHYSHPPLVERL AL+D+DSKKED Sbjct: 395 TDPWYSAYHYSHPPLVERLQALEDSDSKKED 425 >emb|CAL26913.1| CAAX peptidase [Hordeum vulgare subsp. vulgare] Length = 425 Score = 60.1 bits (144), Expect = 6e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 382 TDPLYSVYHYSHPPLVERLAALDDADSKKED 290 TDP YS YHYSHPPLVERL+AL+D DSKKED Sbjct: 395 TDPWYSAYHYSHPPLVERLSALEDLDSKKED 425 >gb|KQL30940.1| hypothetical protein SETIT_016781mg [Setaria italica] Length = 569 Score = 60.1 bits (144), Expect = 6e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 382 TDPLYSVYHYSHPPLVERLAALDDADSKKED 290 TDP YS YHYSHPPLVERL AL+D+DSKKED Sbjct: 539 TDPWYSAYHYSHPPLVERLQALEDSDSKKED 569 >gb|AQK54270.1| CAAX prenyl protease 1 [Zea mays] Length = 628 Score = 60.1 bits (144), Expect = 7e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 382 TDPLYSVYHYSHPPLVERLAALDDADSKKED 290 TDP YS YHYSHPPLVERL AL+D+DSKKED Sbjct: 598 TDPWYSAYHYSHPPLVERLQALEDSDSKKED 628 >gb|AAM76469.1| putative CAAX prenyl protease, partial [Gossypium herbaceum] gb|AAM76470.1| putative CAAX prenyl protease, partial [Gossypium raimondii] gb|AAM76471.1| putative CAAX prenyl protease, partial [Gossypium hirsutum] gb|AAM76473.1| putative CAAX prenyl protease, partial [Gossypioides kirkii] Length = 55 Score = 55.5 bits (132), Expect = 7e-08 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 382 TDPLYSVYHYSHPPLVERLAALDDADSKKE 293 TDP YS YHYSHPPLVERLAA+D AD K+E Sbjct: 26 TDPWYSAYHYSHPPLVERLAAIDAADKKEE 55 >gb|AAM76472.1| putative CAAX prenyl protease, partial [Gossypium hirsutum] Length = 55 Score = 55.5 bits (132), Expect = 7e-08 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 382 TDPLYSVYHYSHPPLVERLAALDDADSKKE 293 TDP YS YHYSHPPLVERLAA+D AD K+E Sbjct: 26 TDPWYSTYHYSHPPLVERLAAIDAADKKEE 55 >ref|XP_020689270.1| CAAX prenyl protease 1 homolog [Dendrobium catenatum] Length = 425 Score = 59.7 bits (143), Expect = 8e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 382 TDPLYSVYHYSHPPLVERLAALDDADSKKED 290 TDP YS YHYSHPPLVERLAAL+D +SKKED Sbjct: 395 TDPWYSAYHYSHPPLVERLAALEDLESKKED 425 >gb|PKU86981.1| CAAX prenyl protease 1 like [Dendrobium catenatum] Length = 467 Score = 59.7 bits (143), Expect = 8e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 382 TDPLYSVYHYSHPPLVERLAALDDADSKKED 290 TDP YS YHYSHPPLVERLAAL+D +SKKED Sbjct: 437 TDPWYSAYHYSHPPLVERLAALEDLESKKED 467 >ref|XP_018681895.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Musa acuminata subsp. malaccensis] Length = 403 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 382 TDPLYSVYHYSHPPLVERLAALDDADSKKED 290 TDP YS YHYSHPPLVERLAA+++ DSKKED Sbjct: 373 TDPWYSAYHYSHPPLVERLAAIEEPDSKKED 403 >ref|XP_009400731.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Musa acuminata subsp. malaccensis] Length = 425 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 382 TDPLYSVYHYSHPPLVERLAALDDADSKKED 290 TDP YS YHYSHPPLVERLAA+++ DSKKED Sbjct: 395 TDPWYSAYHYSHPPLVERLAAIEEPDSKKED 425 >gb|OAY73710.1| CAAX prenyl protease [Ananas comosus] Length = 387 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -3 Query: 382 TDPLYSVYHYSHPPLVERLAALDDADSKKED 290 TDP YS YHYSHPPLVERLAALD+ SKKED Sbjct: 357 TDPWYSAYHYSHPPLVERLAALDEPGSKKED 387 >ref|XP_020094591.1| CAAX prenyl protease 1 homolog [Ananas comosus] Length = 425 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -3 Query: 382 TDPLYSVYHYSHPPLVERLAALDDADSKKED 290 TDP YS YHYSHPPLVERLAALD+ SKKED Sbjct: 395 TDPWYSAYHYSHPPLVERLAALDEPGSKKED 425