BLASTX nr result
ID: Ophiopogon24_contig00002597
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00002597 (634 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010942679.1| PREDICTED: hepatoma-derived growth factor-re... 59 9e-07 ref|XP_010942677.1| PREDICTED: hepatoma-derived growth factor-re... 59 1e-06 >ref|XP_010942679.1| PREDICTED: hepatoma-derived growth factor-related protein 2-like isoform X2 [Elaeis guineensis] Length = 475 Score = 59.3 bits (142), Expect = 9e-07 Identities = 45/105 (42%), Positives = 59/105 (56%), Gaps = 8/105 (7%) Frame = -1 Query: 595 EKAERIRLKMMHGEKKPKKQGALGKANVIEMEKVGTPKGENLKQ--------KDVMETIQ 440 E+AE+ K+ K KQG G+++VIE G + +N+ Q D E Sbjct: 367 ERAEKDGDKISKHNKT--KQGKEGRSSVIENATDGVSEVKNVNQMGSRVPKHSDTNEQ-H 423 Query: 439 TTSPGSIKINAPEEPTPNLSE*RMRVMQSLGLIAPLGSPY*RYGF 305 T SPG IK P++ + +LS R RVMQSLGLIAPLGSP+ R GF Sbjct: 424 TESPGLIKYGIPQQ-SGDLSARRTRVMQSLGLIAPLGSPFRRNGF 467 >ref|XP_010942677.1| PREDICTED: hepatoma-derived growth factor-related protein 2-like isoform X1 [Elaeis guineensis] ref|XP_010942678.1| PREDICTED: hepatoma-derived growth factor-related protein 2-like isoform X1 [Elaeis guineensis] Length = 485 Score = 59.3 bits (142), Expect = 1e-06 Identities = 45/105 (42%), Positives = 59/105 (56%), Gaps = 8/105 (7%) Frame = -1 Query: 595 EKAERIRLKMMHGEKKPKKQGALGKANVIEMEKVGTPKGENLKQ--------KDVMETIQ 440 E+AE+ K+ K KQG G+++VIE G + +N+ Q D E Sbjct: 377 ERAEKDGDKISKHNKT--KQGKEGRSSVIENATDGVSEVKNVNQMGSRVPKHSDTNEQ-H 433 Query: 439 TTSPGSIKINAPEEPTPNLSE*RMRVMQSLGLIAPLGSPY*RYGF 305 T SPG IK P++ + +LS R RVMQSLGLIAPLGSP+ R GF Sbjct: 434 TESPGLIKYGIPQQ-SGDLSARRTRVMQSLGLIAPLGSPFRRNGF 477