BLASTX nr result
ID: Ophiopogon24_contig00002364
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00002364 (387 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020244643.1| RING-H2 finger protein ATL47-like [Asparagus... 96 2e-22 ref|XP_010917327.1| PREDICTED: E3 ubiquitin-protein ligase ATL9-... 64 6e-10 ref|XP_009402028.1| PREDICTED: E3 ubiquitin-protein ligase Os03g... 63 1e-09 ref|XP_008799973.1| PREDICTED: E3 ubiquitin-protein ligase EL5-l... 62 4e-09 ref|XP_009380718.1| PREDICTED: RING-H2 finger protein ATL74-like... 62 6e-09 ref|XP_008804522.1| PREDICTED: E3 ubiquitin-protein ligase EL5-l... 61 6e-09 ref|XP_010932314.1| PREDICTED: E3 ubiquitin-protein ligase EL5-l... 56 5e-07 ref|XP_009409571.1| PREDICTED: E3 ubiquitin-protein ligase EL5-l... 55 9e-07 >ref|XP_020244643.1| RING-H2 finger protein ATL47-like [Asparagus officinalis] gb|ONK61187.1| uncharacterized protein A4U43_C08F27120 [Asparagus officinalis] Length = 156 Score = 95.5 bits (236), Expect = 2e-22 Identities = 48/98 (48%), Positives = 55/98 (56%) Frame = +1 Query: 94 MSISVEYYCXXXXXXXXXXXXXXXXXXXXXAVLNDHEPPGGGQADITRKAVRDGLSVSTY 273 MSIS+EYYC A+ + E P G Q+DI RKAVRD L V+TY Sbjct: 1 MSISMEYYCSRLEIFLSLLIKWLLLPVRWLAIWTNRESPHGNQSDIMRKAVRDSLHVATY 60 Query: 274 GELAXXXXXXXXXCAVCLGEVRGEDRVWVLRNCNHVFH 387 GEL CAVCL EV+G DRVW LRNC+HVFH Sbjct: 61 GELIMKTTVEETTCAVCLSEVQGRDRVWELRNCSHVFH 98 >ref|XP_010917327.1| PREDICTED: E3 ubiquitin-protein ligase ATL9-like [Elaeis guineensis] Length = 180 Score = 63.9 bits (154), Expect = 6e-10 Identities = 31/51 (60%), Positives = 36/51 (70%), Gaps = 1/51 (1%) Frame = +1 Query: 238 KAVRDGLSVSTYGELAXXXXXXXXX-CAVCLGEVRGEDRVWVLRNCNHVFH 387 +AVR+ L V+TYGE+A CAVCL EVRG+DRVW LRNC HVFH Sbjct: 68 QAVRESLQVATYGEVAGAAGAAAAATCAVCLSEVRGKDRVWELRNCCHVFH 118 >ref|XP_009402028.1| PREDICTED: E3 ubiquitin-protein ligase Os03g0188200-like [Musa acuminata subsp. malaccensis] Length = 175 Score = 63.2 bits (152), Expect = 1e-09 Identities = 29/53 (54%), Positives = 33/53 (62%) Frame = +1 Query: 229 ITRKAVRDGLSVSTYGELAXXXXXXXXXCAVCLGEVRGEDRVWVLRNCNHVFH 387 + +AVRD L VS+YG L CAVCL E+R DRVW LRNC HVFH Sbjct: 61 VAAQAVRDSLHVSSYGALTGAAAEGVTTCAVCLSEMRTRDRVWELRNCAHVFH 113 >ref|XP_008799973.1| PREDICTED: E3 ubiquitin-protein ligase EL5-like [Phoenix dactylifera] Length = 231 Score = 62.4 bits (150), Expect = 4e-09 Identities = 28/50 (56%), Positives = 34/50 (68%) Frame = +1 Query: 238 KAVRDGLSVSTYGELAXXXXXXXXXCAVCLGEVRGEDRVWVLRNCNHVFH 387 +AVR+ L V+TYGE+ CAVCL EV +DRVW LRNC+HVFH Sbjct: 67 QAVRESLQVATYGEVEGEAAAAAMTCAVCLSEVGRKDRVWELRNCSHVFH 116 >ref|XP_009380718.1| PREDICTED: RING-H2 finger protein ATL74-like [Musa acuminata subsp. malaccensis] Length = 197 Score = 61.6 bits (148), Expect = 6e-09 Identities = 31/51 (60%), Positives = 34/51 (66%), Gaps = 1/51 (1%) Frame = +1 Query: 238 KAVRDGLSVSTYGEL-AXXXXXXXXXCAVCLGEVRGEDRVWVLRNCNHVFH 387 +AVR+GL VSTYGEL A CAVCL EV +RVW LRNC HVFH Sbjct: 76 QAVREGLRVSTYGELVAEQEEAAAATCAVCLSEVGRRERVWELRNCRHVFH 126 >ref|XP_008804522.1| PREDICTED: E3 ubiquitin-protein ligase EL5-like [Phoenix dactylifera] Length = 177 Score = 61.2 bits (147), Expect = 6e-09 Identities = 30/50 (60%), Positives = 35/50 (70%) Frame = +1 Query: 238 KAVRDGLSVSTYGELAXXXXXXXXXCAVCLGEVRGEDRVWVLRNCNHVFH 387 +AVR+ L V+TYGE+A CAVCL EVR +DRVW LRNC HVFH Sbjct: 68 QAVRESLQVATYGEVAAAAAAAAT-CAVCLSEVRRKDRVWELRNCCHVFH 116 >ref|XP_010932314.1| PREDICTED: E3 ubiquitin-protein ligase EL5-like [Elaeis guineensis] Length = 180 Score = 56.2 bits (134), Expect = 5e-07 Identities = 28/51 (54%), Positives = 33/51 (64%), Gaps = 1/51 (1%) Frame = +1 Query: 238 KAVRDGLSVSTYGELAXXXXXXXXX-CAVCLGEVRGEDRVWVLRNCNHVFH 387 +AVR+ L V+TY E+A CAVCL EV +DRVW LRNC HVFH Sbjct: 67 QAVRESLQVATYEEVAGEAAAAAATRCAVCLSEVGRKDRVWELRNCRHVFH 117 >ref|XP_009409571.1| PREDICTED: E3 ubiquitin-protein ligase EL5-like [Musa acuminata subsp. malaccensis] Length = 177 Score = 55.5 bits (132), Expect = 9e-07 Identities = 33/72 (45%), Positives = 38/72 (52%), Gaps = 8/72 (11%) Frame = +1 Query: 196 DHEPPGGGQADITR-----KAVRDGLSVSTYGELAXXXXXXXXX---CAVCLGEVRGEDR 351 D G G D R +AVR+ L VST+GE+A CAVCL EV D+ Sbjct: 47 DEAEGGKGAEDRARHRAAAQAVRETLHVSTFGEVAGEEEEAGAVATACAVCLSEVSRWDK 106 Query: 352 VWVLRNCNHVFH 387 VW LRNC HVFH Sbjct: 107 VWELRNCRHVFH 118