BLASTX nr result
ID: Ophiopogon24_contig00002119
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00002119 (475 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK58103.1| uncharacterized protein A4U43_C09F8140 [Asparagus... 58 9e-07 ref|XP_020246783.1| DNA ligase 6 [Asparagus officinalis] 58 1e-06 >gb|ONK58103.1| uncharacterized protein A4U43_C09F8140 [Asparagus officinalis] Length = 352 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +1 Query: 370 SHSIDFSASSLEMVPGTPIPLMLAKITNGTLHVL 471 S I+FS SSLEMVPGTPIP MLA+ITNGTLHVL Sbjct: 60 SKGINFSGSSLEMVPGTPIPPMLARITNGTLHVL 93 >ref|XP_020246783.1| DNA ligase 6 [Asparagus officinalis] Length = 1407 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +1 Query: 370 SHSIDFSASSLEMVPGTPIPLMLAKITNGTLHVL 471 S I+FS SSLEMVPGTPIP MLA+ITNGTLHVL Sbjct: 1004 SKGINFSGSSLEMVPGTPIPPMLARITNGTLHVL 1037