BLASTX nr result
ID: Ophiopogon24_contig00001785
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00001785 (380 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ96680.1| predicted protein [Hordeum vulgare subsp. vulgare] 61 3e-08 ref|XP_020091832.1| cysteine-rich receptor-like protein kinase 6... 60 9e-08 gb|OAY81561.1| Cysteine-rich receptor-like protein kinase 25 [An... 60 9e-08 ref|XP_020106067.1| putative receptor-like protein kinase At4g00... 59 2e-07 gb|ADX41478.1| STK disease resistance protein-like protein, part... 57 3e-07 ref|XP_020155796.1| cysteine-rich receptor-like protein kinase 6... 58 3e-07 ref|XP_020155795.1| cysteine-rich receptor-like protein kinase 6... 58 3e-07 gb|EMS68893.1| Cysteine-rich receptor-like protein kinase 10 [Tr... 58 3e-07 ref|XP_003560123.1| PREDICTED: cysteine-rich receptor-like prote... 58 4e-07 ref|XP_010931306.1| PREDICTED: cysteine-rich receptor-like prote... 58 4e-07 ref|XP_010910126.1| PREDICTED: cysteine-rich receptor-like prote... 58 4e-07 ref|XP_019703096.1| PREDICTED: cysteine-rich receptor-like prote... 58 4e-07 gb|PNT74975.1| hypothetical protein BRADI_1g25600v3 [Brachypodiu... 57 5e-07 ref|XP_010237428.1| PREDICTED: putative receptor-like protein ki... 57 6e-07 ref|XP_009405651.1| PREDICTED: putative receptor-like protein ki... 57 6e-07 ref|XP_003560124.1| PREDICTED: putative receptor-like protein ki... 57 6e-07 ref|XP_017700814.1| PREDICTED: putative receptor-like protein ki... 57 6e-07 ref|XP_008804396.1| PREDICTED: putative receptor-like protein ki... 57 6e-07 ref|XP_022139508.1| G-type lectin S-receptor-like serine/threoni... 57 8e-07 ref|XP_022139507.1| G-type lectin S-receptor-like serine/threoni... 57 8e-07 >dbj|BAJ96680.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 678 Score = 60.8 bits (146), Expect = 3e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +2 Query: 2 LSDRQEIAVKRLSAHSKQGLGELKNKLVLVAKLQHRN 112 L D QEIAVKRLS HS QG+GELKN+LVLVAKLQH+N Sbjct: 368 LPDGQEIAVKRLSRHSGQGIGELKNELVLVAKLQHKN 404 >ref|XP_020091832.1| cysteine-rich receptor-like protein kinase 6 [Ananas comosus] Length = 689 Score = 59.7 bits (143), Expect = 9e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +2 Query: 2 LSDRQEIAVKRLSAHSKQGLGELKNKLVLVAKLQHRN 112 L D QEIAVKRLS S+QGLGELKN+LVLVAKLQH+N Sbjct: 376 LPDGQEIAVKRLSKDSRQGLGELKNELVLVAKLQHKN 412 >gb|OAY81561.1| Cysteine-rich receptor-like protein kinase 25 [Ananas comosus] Length = 1797 Score = 59.7 bits (143), Expect = 9e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +2 Query: 2 LSDRQEIAVKRLSAHSKQGLGELKNKLVLVAKLQHRN 112 L D QEIAVKRLS S+QGLGELKN+LVLVAKLQH+N Sbjct: 869 LPDGQEIAVKRLSKDSRQGLGELKNELVLVAKLQHKN 905 Score = 54.7 bits (130), Expect = 5e-06 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +2 Query: 2 LSDRQEIAVKRLSAHSKQGLGELKNKLVLVAKLQHRN 112 L D +EIAVKRLS S QGLGELKN+L LVAKLQH+N Sbjct: 189 LPDGREIAVKRLSKDSGQGLGELKNELFLVAKLQHKN 225 Score = 54.7 bits (130), Expect = 5e-06 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +2 Query: 2 LSDRQEIAVKRLSAHSKQGLGELKNKLVLVAKLQHRN 112 L D QEIAVKRLS S QGL ELKN++VLVAKLQHRN Sbjct: 1484 LHDGQEIAVKRLSMSSVQGLVELKNEVVLVAKLQHRN 1520 >ref|XP_020106067.1| putative receptor-like protein kinase At4g00960 [Ananas comosus] Length = 686 Score = 58.9 bits (141), Expect = 2e-07 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +2 Query: 2 LSDRQEIAVKRLSAHSKQGLGELKNKLVLVAKLQHRN 112 L D QEIAVKRLS S QGLGELKN+LVLVAKLQH+N Sbjct: 376 LQDGQEIAVKRLSMSSAQGLGELKNELVLVAKLQHKN 412 >gb|ADX41478.1| STK disease resistance protein-like protein, partial [Setaria italica] Length = 172 Score = 56.6 bits (135), Expect = 3e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +2 Query: 2 LSDRQEIAVKRLSAHSKQGLGELKNKLVLVAKLQHRN 112 L D QEIAVKRLS S+QG+ ELKN+LVLVAKLQH+N Sbjct: 19 LPDNQEIAVKRLSQSSRQGIEELKNELVLVAKLQHKN 55 >ref|XP_020155796.1| cysteine-rich receptor-like protein kinase 6 isoform X2 [Aegilops tauschii subsp. tauschii] Length = 515 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +2 Query: 2 LSDRQEIAVKRLSAHSKQGLGELKNKLVLVAKLQHRN 112 L D QEIAVKRLS +S QG+GELKN+LVLVAKLQH+N Sbjct: 369 LPDGQEIAVKRLSRNSGQGIGELKNELVLVAKLQHKN 405 >ref|XP_020155795.1| cysteine-rich receptor-like protein kinase 6 isoform X1 [Aegilops tauschii subsp. tauschii] Length = 678 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +2 Query: 2 LSDRQEIAVKRLSAHSKQGLGELKNKLVLVAKLQHRN 112 L D QEIAVKRLS +S QG+GELKN+LVLVAKLQH+N Sbjct: 368 LPDGQEIAVKRLSRNSGQGIGELKNELVLVAKLQHKN 404 >gb|EMS68893.1| Cysteine-rich receptor-like protein kinase 10 [Triticum urartu] Length = 715 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +2 Query: 2 LSDRQEIAVKRLSAHSKQGLGELKNKLVLVAKLQHRN 112 L D QEIAVKRLS +S QG+GELKN+LVLVAKLQH+N Sbjct: 355 LPDGQEIAVKRLSRNSGQGIGELKNELVLVAKLQHKN 391 >ref|XP_003560123.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Brachypodium distachyon] gb|KQK15889.1| hypothetical protein BRADI_1g25588v3 [Brachypodium distachyon] Length = 659 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +2 Query: 2 LSDRQEIAVKRLSAHSKQGLGELKNKLVLVAKLQHRN 112 L D QEIAVKRLS S QG+GELKN+LVLVAKLQH+N Sbjct: 367 LPDGQEIAVKRLSKSSAQGIGELKNELVLVAKLQHKN 403 >ref|XP_010931306.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Elaeis guineensis] Length = 681 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +2 Query: 2 LSDRQEIAVKRLSAHSKQGLGELKNKLVLVAKLQHRN 112 L D +EIAVKRLS S QGLGELKN+L+LVAKLQHRN Sbjct: 370 LPDGREIAVKRLSTSSSQGLGELKNELLLVAKLQHRN 406 >ref|XP_010910126.1| PREDICTED: cysteine-rich receptor-like protein kinase 6 isoform X1 [Elaeis guineensis] Length = 683 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +2 Query: 2 LSDRQEIAVKRLSAHSKQGLGELKNKLVLVAKLQHRN 112 L D QEIAVKRLS S QG GEL+N+LVLVAKLQHRN Sbjct: 370 LPDGQEIAVKRLSTSSSQGFGELRNELVLVAKLQHRN 406 >ref|XP_019703096.1| PREDICTED: cysteine-rich receptor-like protein kinase 6 isoform X2 [Elaeis guineensis] Length = 696 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +2 Query: 2 LSDRQEIAVKRLSAHSKQGLGELKNKLVLVAKLQHRN 112 L D QEIAVKRLS S QG GEL+N+LVLVAKLQHRN Sbjct: 383 LPDGQEIAVKRLSTSSSQGFGELRNELVLVAKLQHRN 419 >gb|PNT74975.1| hypothetical protein BRADI_1g25600v3 [Brachypodium distachyon] Length = 402 Score = 57.4 bits (137), Expect = 5e-07 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +2 Query: 2 LSDRQEIAVKRLSAHSKQGLGELKNKLVLVAKLQHRN 112 L D QEIAVKRLS S QG+GELKN+LVLVAKLQH+N Sbjct: 93 LPDGQEIAVKRLSRSSGQGIGELKNELVLVAKLQHKN 129 >ref|XP_010237428.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform X2 [Brachypodium distachyon] Length = 677 Score = 57.4 bits (137), Expect = 6e-07 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +2 Query: 2 LSDRQEIAVKRLSAHSKQGLGELKNKLVLVAKLQHRN 112 L D QEIAVKRLS S QG+GELKN+LVLVAKLQH+N Sbjct: 368 LPDGQEIAVKRLSRSSGQGIGELKNELVLVAKLQHKN 404 >ref|XP_009405651.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Musa acuminata subsp. malaccensis] Length = 677 Score = 57.4 bits (137), Expect = 6e-07 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +2 Query: 2 LSDRQEIAVKRLSAHSKQGLGELKNKLVLVAKLQHRN 112 L D +EIAVKRLS S QGLGELKN+LVLVAKLQHRN Sbjct: 366 LPDGREIAVKRLSNSSGQGLGELKNELVLVAKLQHRN 402 >ref|XP_003560124.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform X1 [Brachypodium distachyon] gb|KQK15891.1| hypothetical protein BRADI_1g25600v3 [Brachypodium distachyon] Length = 682 Score = 57.4 bits (137), Expect = 6e-07 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +2 Query: 2 LSDRQEIAVKRLSAHSKQGLGELKNKLVLVAKLQHRN 112 L D QEIAVKRLS S QG+GELKN+LVLVAKLQH+N Sbjct: 373 LPDGQEIAVKRLSRSSGQGIGELKNELVLVAKLQHKN 409 >ref|XP_017700814.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform X2 [Phoenix dactylifera] Length = 683 Score = 57.4 bits (137), Expect = 6e-07 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +2 Query: 2 LSDRQEIAVKRLSAHSKQGLGELKNKLVLVAKLQHRN 112 L D +EIAVKRLS S QGLGELKN+LVLVA+LQHRN Sbjct: 372 LPDGREIAVKRLSTSSTQGLGELKNELVLVARLQHRN 408 >ref|XP_008804396.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform X1 [Phoenix dactylifera] Length = 683 Score = 57.4 bits (137), Expect = 6e-07 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +2 Query: 2 LSDRQEIAVKRLSAHSKQGLGELKNKLVLVAKLQHRN 112 L D +EIAVKRLS S QGLGELKN+LVLVA+LQHRN Sbjct: 372 LPDGREIAVKRLSTSSTQGLGELKNELVLVARLQHRN 408 >ref|XP_022139508.1| G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 isoform X3 [Momordica charantia] ref|XP_022139509.1| G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 isoform X4 [Momordica charantia] Length = 654 Score = 57.0 bits (136), Expect = 8e-07 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = +2 Query: 2 LSDRQEIAVKRLSAHSKQGLGELKNKLVLVAKLQHRN 112 L+D QEIAVKRLS++SKQG E KN+++L+AKLQHRN Sbjct: 508 LTDGQEIAVKRLSSYSKQGANEFKNEVILIAKLQHRN 544 >ref|XP_022139507.1| G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 isoform X2 [Momordica charantia] Length = 767 Score = 57.0 bits (136), Expect = 8e-07 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = +2 Query: 2 LSDRQEIAVKRLSAHSKQGLGELKNKLVLVAKLQHRN 112 L+D QEIAVKRLS++SKQG E KN+++L+AKLQHRN Sbjct: 469 LTDGQEIAVKRLSSYSKQGANEFKNEVILIAKLQHRN 505