BLASTX nr result
ID: Ophiopogon24_contig00001412
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00001412 (810 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK64080.1| uncharacterized protein A4U43_C07F21880 [Asparagu... 62 3e-07 ref|XP_020272208.1| lysine-specific demethylase 5A [Asparagus of... 62 4e-07 ref|XP_019072558.1| PREDICTED: lysine-specific demethylase 5B is... 60 2e-06 emb|CBI34675.3| unnamed protein product, partial [Vitis vinifera] 60 2e-06 ref|XP_017697859.1| PREDICTED: LOW QUALITY PROTEIN: lysine-speci... 60 3e-06 ref|XP_010660768.1| PREDICTED: lysine-specific demethylase 5B is... 60 3e-06 ref|XP_010660765.1| PREDICTED: lysine-specific demethylase 5B is... 60 3e-06 ref|XP_010660760.1| PREDICTED: lysine-specific demethylase 5B is... 60 3e-06 ref|XP_010660757.1| PREDICTED: lysine-specific demethylase 5B is... 60 3e-06 gb|PIA34192.1| hypothetical protein AQUCO_03800045v1 [Aquilegia ... 59 5e-06 >gb|ONK64080.1| uncharacterized protein A4U43_C07F21880 [Asparagus officinalis] Length = 475 Score = 62.0 bits (149), Expect = 3e-07 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +1 Query: 709 SEVCKLISEGESLPVHFEKEMKLLRDQSVLYCIC 810 SEV KLI+EG+SLPVHF+KEMKLLR++SVLYCIC Sbjct: 300 SEVFKLITEGKSLPVHFDKEMKLLRERSVLYCIC 333 >ref|XP_020272208.1| lysine-specific demethylase 5A [Asparagus officinalis] Length = 1826 Score = 62.0 bits (149), Expect = 4e-07 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +1 Query: 709 SEVCKLISEGESLPVHFEKEMKLLRDQSVLYCIC 810 SEV KLI+EG+SLPVHF+KEMKLLR++SVLYCIC Sbjct: 1651 SEVFKLITEGKSLPVHFDKEMKLLRERSVLYCIC 1684 >ref|XP_019072558.1| PREDICTED: lysine-specific demethylase 5B isoform X5 [Vitis vinifera] Length = 1389 Score = 59.7 bits (143), Expect = 2e-06 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = +1 Query: 712 EVCKLISEGESLPVHFEKEMKLLRDQSVLYCIC 810 EVC+LI++GE+LPVHFEKE+KLLR +S+LYCIC Sbjct: 1221 EVCELITQGENLPVHFEKELKLLRARSMLYCIC 1253 >emb|CBI34675.3| unnamed protein product, partial [Vitis vinifera] Length = 1495 Score = 59.7 bits (143), Expect = 2e-06 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = +1 Query: 712 EVCKLISEGESLPVHFEKEMKLLRDQSVLYCIC 810 EVC+LI++GE+LPVHFEKE+KLLR +S+LYCIC Sbjct: 1327 EVCELITQGENLPVHFEKELKLLRARSMLYCIC 1359 >ref|XP_017697859.1| PREDICTED: LOW QUALITY PROTEIN: lysine-specific demethylase 5A [Phoenix dactylifera] Length = 1589 Score = 59.7 bits (143), Expect = 3e-06 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 709 SEVCKLISEGESLPVHFEKEMKLLRDQSVLYCIC 810 SEV K+ISEGESLPVHFEKE+KLL+ +S LYCIC Sbjct: 1414 SEVFKVISEGESLPVHFEKELKLLKTRSTLYCIC 1447 >ref|XP_010660768.1| PREDICTED: lysine-specific demethylase 5B isoform X4 [Vitis vinifera] Length = 1851 Score = 59.7 bits (143), Expect = 3e-06 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = +1 Query: 712 EVCKLISEGESLPVHFEKEMKLLRDQSVLYCIC 810 EVC+LI++GE+LPVHFEKE+KLLR +S+LYCIC Sbjct: 1683 EVCELITQGENLPVHFEKELKLLRARSMLYCIC 1715 >ref|XP_010660765.1| PREDICTED: lysine-specific demethylase 5B isoform X3 [Vitis vinifera] Length = 1852 Score = 59.7 bits (143), Expect = 3e-06 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = +1 Query: 712 EVCKLISEGESLPVHFEKEMKLLRDQSVLYCIC 810 EVC+LI++GE+LPVHFEKE+KLLR +S+LYCIC Sbjct: 1684 EVCELITQGENLPVHFEKELKLLRARSMLYCIC 1716 >ref|XP_010660760.1| PREDICTED: lysine-specific demethylase 5B isoform X2 [Vitis vinifera] Length = 1854 Score = 59.7 bits (143), Expect = 3e-06 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = +1 Query: 712 EVCKLISEGESLPVHFEKEMKLLRDQSVLYCIC 810 EVC+LI++GE+LPVHFEKE+KLLR +S+LYCIC Sbjct: 1686 EVCELITQGENLPVHFEKELKLLRARSMLYCIC 1718 >ref|XP_010660757.1| PREDICTED: lysine-specific demethylase 5B isoform X1 [Vitis vinifera] Length = 1855 Score = 59.7 bits (143), Expect = 3e-06 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = +1 Query: 712 EVCKLISEGESLPVHFEKEMKLLRDQSVLYCIC 810 EVC+LI++GE+LPVHFEKE+KLLR +S+LYCIC Sbjct: 1687 EVCELITQGENLPVHFEKELKLLRARSMLYCIC 1719 >gb|PIA34192.1| hypothetical protein AQUCO_03800045v1 [Aquilegia coerulea] Length = 1852 Score = 58.9 bits (141), Expect = 5e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +1 Query: 712 EVCKLISEGESLPVHFEKEMKLLRDQSVLYCIC 810 EV KLI EGE+LPVHFEKE+KLLR +SVLYCIC Sbjct: 1683 EVFKLIEEGENLPVHFEKELKLLRARSVLYCIC 1715