BLASTX nr result
ID: Ophiopogon24_contig00001270
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00001270 (2282 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|POE79129.1| ubiquitin-conjugating enzyme e2-17 kda [Quercus s... 75 9e-13 ref|XP_022856019.1| ubiquitin-conjugating enzyme E2-17 kDa-like ... 75 2e-12 ref|XP_022945591.1| SUMO-conjugating enzyme UBC9 isoform X2 [Cuc... 75 2e-12 gb|PPS08494.1| hypothetical protein GOBAR_AA12120 [Gossypium bar... 75 2e-12 ref|XP_008359831.1| PREDICTED: SUMO-conjugating enzyme UBC9-like... 75 2e-12 ref|XP_022866477.1| ubiquitin-conjugating enzyme E2-17 kDa-like ... 74 4e-12 gb|KRH53430.1| hypothetical protein GLYMA_06G124900 [Glycine max] 75 4e-12 dbj|BAS91527.1| Os04g0667800, partial [Oryza sativa Japonica Group] 72 4e-12 ref|XP_006385788.1| hypothetical protein POPTR_0003s13600g [Popu... 74 4e-12 gb|PPR82315.1| hypothetical protein GOBAR_AA38398 [Gossypium bar... 75 5e-12 gb|KHN18652.1| Ubiquitin-conjugating enzyme E2 28 [Glycine soja] 74 6e-12 gb|KHG30069.1| Ubiquitin-conjugating enzyme E2-17 kDa [Gossypium... 74 6e-12 gb|ESQ54462.1| hypothetical protein EUTSA_v10026967mg [Eutrema s... 74 6e-12 ref|XP_003626536.1| ubiquitin-conjugating enzyme E2 [Medicago tr... 75 6e-12 ref|XP_022147329.1| ubiquitin-conjugating enzyme E2-17 kDa-like ... 75 7e-12 ref|XP_011000373.1| PREDICTED: ubiquitin-conjugating enzyme E2-1... 72 1e-11 gb|KRG97125.1| hypothetical protein GLYMA_19G2530001, partial [G... 71 1e-11 gb|AVD69609.1| ubiquitin-conjugating protein, partial [Solanum p... 71 1e-11 gb|KJB22191.1| hypothetical protein B456_004G034300 [Gossypium r... 72 1e-11 gb|KRG97124.1| hypothetical protein GLYMA_19G2530001, partial [G... 71 1e-11 >gb|POE79129.1| ubiquitin-conjugating enzyme e2-17 kda [Quercus suber] Length = 92 Score = 75.1 bits (183), Expect = 9e-13 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = -1 Query: 506 SGSVSFRTKVFHPNINSNGSICLDILKEQWSPAPAISKV 390 +G VSFRTKVFHPNINSNGSICLDILKEQWSPA ISKV Sbjct: 8 TGQVSFRTKVFHPNINSNGSICLDILKEQWSPALTISKV 46 >ref|XP_022856019.1| ubiquitin-conjugating enzyme E2-17 kDa-like [Olea europaea var. sylvestris] Length = 103 Score = 74.7 bits (182), Expect = 2e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -1 Query: 497 VSFRTKVFHPNINSNGSICLDILKEQWSPAPAISKVC 387 V+FRTKVFHPNINSNGSICLDILKEQWSPA ISKVC Sbjct: 67 VAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVC 103 >ref|XP_022945591.1| SUMO-conjugating enzyme UBC9 isoform X2 [Cucurbita moschata] Length = 104 Score = 74.7 bits (182), Expect = 2e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -1 Query: 497 VSFRTKVFHPNINSNGSICLDILKEQWSPAPAISKVC 387 V+FRTKVFHPNINSNGSICLDILKEQWSPA ISKVC Sbjct: 67 VAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVC 103 >gb|PPS08494.1| hypothetical protein GOBAR_AA12120 [Gossypium barbadense] Length = 107 Score = 74.7 bits (182), Expect = 2e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -1 Query: 497 VSFRTKVFHPNINSNGSICLDILKEQWSPAPAISKVC 387 V+FRTKVFHPNINSNGSICLDILKEQWSPA ISKVC Sbjct: 67 VAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVC 103 >ref|XP_008359831.1| PREDICTED: SUMO-conjugating enzyme UBC9-like [Malus domestica] Length = 107 Score = 74.7 bits (182), Expect = 2e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -1 Query: 497 VSFRTKVFHPNINSNGSICLDILKEQWSPAPAISKVC 387 V+FRTKVFHPNINSNGSICLDILKEQWSPA ISKVC Sbjct: 67 VAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVC 103 >ref|XP_022866477.1| ubiquitin-conjugating enzyme E2-17 kDa-like [Olea europaea var. sylvestris] Length = 121 Score = 74.3 bits (181), Expect = 4e-12 Identities = 37/50 (74%), Positives = 41/50 (82%) Frame = -1 Query: 539 HIL*ANMSMIGSGSVSFRTKVFHPNINSNGSICLDILKEQWSPAPAISKV 390 +IL + + GS VSF+TKVFHPNINSNGSICLDILKEQWSPA ISKV Sbjct: 26 YILFNDYVLRGSVQVSFKTKVFHPNINSNGSICLDILKEQWSPALTISKV 75 >gb|KRH53430.1| hypothetical protein GLYMA_06G124900 [Glycine max] Length = 136 Score = 74.7 bits (182), Expect = 4e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -1 Query: 497 VSFRTKVFHPNINSNGSICLDILKEQWSPAPAISKVC 387 V+FRTKVFHPNINSNGSICLDILKEQWSPA ISKVC Sbjct: 67 VAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVC 103 >dbj|BAS91527.1| Os04g0667800, partial [Oryza sativa Japonica Group] Length = 72 Score = 72.4 bits (176), Expect = 4e-12 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -1 Query: 497 VSFRTKVFHPNINSNGSICLDILKEQWSPAPAISKV 390 VSFRTKVFHPNINSNGSICLDILKEQWSPA ISKV Sbjct: 32 VSFRTKVFHPNINSNGSICLDILKEQWSPALTISKV 67 >ref|XP_006385788.1| hypothetical protein POPTR_0003s13600g [Populus trichocarpa] Length = 107 Score = 73.6 bits (179), Expect = 4e-12 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -1 Query: 506 SGSVSFRTKVFHPNINSNGSICLDILKEQWSPAPAISKV 390 +G V+FRTKVFHPNINSNGSICLDILKEQWSPA ISKV Sbjct: 23 AGPVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKV 61 >gb|PPR82315.1| hypothetical protein GOBAR_AA38398 [Gossypium barbadense] Length = 159 Score = 75.1 bits (183), Expect = 5e-12 Identities = 37/43 (86%), Positives = 38/43 (88%) Frame = -1 Query: 518 SMIGSGSVSFRTKVFHPNINSNGSICLDILKEQWSPAPAISKV 390 S I S SV+FRTKVFHPNINSNGSICLDILKEQWSPA ISKV Sbjct: 71 SSIPSFSVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKV 113 >gb|KHN18652.1| Ubiquitin-conjugating enzyme E2 28 [Glycine soja] Length = 130 Score = 73.9 bits (180), Expect = 6e-12 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -1 Query: 506 SGSVSFRTKVFHPNINSNGSICLDILKEQWSPAPAISKV 390 +G V+FRTKVFHPNINSNGSICLDILKEQWSPA ISKV Sbjct: 46 TGGVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKV 84 >gb|KHG30069.1| Ubiquitin-conjugating enzyme E2-17 kDa [Gossypium arboreum] Length = 130 Score = 73.9 bits (180), Expect = 6e-12 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -1 Query: 506 SGSVSFRTKVFHPNINSNGSICLDILKEQWSPAPAISKV 390 +G V+FRTKVFHPNINSNGSICLDILKEQWSPA ISKV Sbjct: 46 AGGVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKV 84 >gb|ESQ54462.1| hypothetical protein EUTSA_v10026967mg [Eutrema salsugineum] Length = 130 Score = 73.9 bits (180), Expect = 6e-12 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -1 Query: 506 SGSVSFRTKVFHPNINSNGSICLDILKEQWSPAPAISKV 390 +G V+FRTKVFHPNINSNGSICLDILKEQWSPA ISKV Sbjct: 46 AGGVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKV 84 >ref|XP_003626536.1| ubiquitin-conjugating enzyme E2 [Medicago truncatula] gb|AES82754.1| ubiquitin-conjugating enzyme E2 [Medicago truncatula] Length = 155 Score = 74.7 bits (182), Expect = 6e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -1 Query: 497 VSFRTKVFHPNINSNGSICLDILKEQWSPAPAISKVC 387 V+FRTKVFHPNINSNGSICLDILKEQWSPA ISKVC Sbjct: 67 VAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVC 103 >ref|XP_022147329.1| ubiquitin-conjugating enzyme E2-17 kDa-like isoform X2 [Momordica charantia] Length = 160 Score = 74.7 bits (182), Expect = 7e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -1 Query: 497 VSFRTKVFHPNINSNGSICLDILKEQWSPAPAISKVC 387 V+FRTKVFHPNINSNGSICLDILKEQWSPA ISKVC Sbjct: 67 VAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVC 103 >ref|XP_011000373.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform X2 [Populus euphratica] Length = 103 Score = 72.4 bits (176), Expect = 1e-11 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -1 Query: 497 VSFRTKVFHPNINSNGSICLDILKEQWSPAPAISKV 390 VSFRTKVFHPNINSNGSICLDILKEQWSPA ISKV Sbjct: 67 VSFRTKVFHPNINSNGSICLDILKEQWSPALTISKV 102 >gb|KRG97125.1| hypothetical protein GLYMA_19G2530001, partial [Glycine max] Length = 71 Score = 71.2 bits (173), Expect = 1e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -1 Query: 497 VSFRTKVFHPNINSNGSICLDILKEQWSPAPAISKV 390 V+FRTKVFHPNINSNGSICLDILKEQWSPA ISKV Sbjct: 1 VAFRTKVFHPNINSNGSICLDILKEQWSPALTISKV 36 >gb|AVD69609.1| ubiquitin-conjugating protein, partial [Solanum pseudocapsicum] Length = 75 Score = 71.2 bits (173), Expect = 1e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -1 Query: 497 VSFRTKVFHPNINSNGSICLDILKEQWSPAPAISKV 390 V+FRTKVFHPNINSNGSICLDILKEQWSPA ISKV Sbjct: 28 VAFRTKVFHPNINSNGSICLDILKEQWSPALTISKV 63 >gb|KJB22191.1| hypothetical protein B456_004G034300 [Gossypium raimondii] Length = 111 Score = 72.4 bits (176), Expect = 1e-11 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -1 Query: 497 VSFRTKVFHPNINSNGSICLDILKEQWSPAPAISKV 390 VSFRTKVFHPNINSNGSICLDILKEQWSPA ISKV Sbjct: 67 VSFRTKVFHPNINSNGSICLDILKEQWSPALTISKV 102 >gb|KRG97124.1| hypothetical protein GLYMA_19G2530001, partial [Glycine max] Length = 82 Score = 71.2 bits (173), Expect = 1e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -1 Query: 497 VSFRTKVFHPNINSNGSICLDILKEQWSPAPAISKV 390 V+FRTKVFHPNINSNGSICLDILKEQWSPA ISKV Sbjct: 1 VAFRTKVFHPNINSNGSICLDILKEQWSPALTISKV 36