BLASTX nr result
ID: Ophiopogon24_contig00001136
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00001136 (380 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020277024.1| pentatricopeptide repeat-containing protein ... 66 4e-10 ref|XP_020277016.1| pentatricopeptide repeat-containing protein ... 66 4e-10 ref|XP_020079889.1| pentatricopeptide repeat-containing protein ... 63 5e-09 ref|XP_020079888.1| pentatricopeptide repeat-containing protein ... 63 5e-09 gb|OAY67414.1| Pentatricopeptide repeat-containing protein, chlo... 62 2e-08 ref|XP_018675412.1| PREDICTED: pentatricopeptide repeat-containi... 60 5e-08 >ref|XP_020277024.1| pentatricopeptide repeat-containing protein At3g04760, chloroplastic isoform X2 [Asparagus officinalis] gb|ONK79603.1| uncharacterized protein A4U43_C01F8050 [Asparagus officinalis] Length = 463 Score = 66.2 bits (160), Expect = 4e-10 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +1 Query: 1 HRAEAMELARELVGKDVFMEGSIRRLNKTFPMLNLYKEMPQ 123 HR EAMELARELV KDVF E S++RL++TFPMLNLYK PQ Sbjct: 412 HRPEAMELARELVSKDVFTEDSVKRLDRTFPMLNLYKGTPQ 452 >ref|XP_020277016.1| pentatricopeptide repeat-containing protein At3g04760, chloroplastic isoform X1 [Asparagus officinalis] Length = 586 Score = 66.2 bits (160), Expect = 4e-10 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +1 Query: 1 HRAEAMELARELVGKDVFMEGSIRRLNKTFPMLNLYKEMPQ 123 HR EAMELARELV KDVF E S++RL++TFPMLNLYK PQ Sbjct: 535 HRPEAMELARELVSKDVFTEDSVKRLDRTFPMLNLYKGTPQ 575 >ref|XP_020079889.1| pentatricopeptide repeat-containing protein At3g04760, chloroplastic-like isoform X2 [Ananas comosus] Length = 603 Score = 63.2 bits (152), Expect = 5e-09 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +1 Query: 1 HRAEAMELARELVGKDVFMEGSIRRLNKTFPMLNLYKEMPQ 123 HR EAM LAREL K+V E S++RLN+TFPMLNLYKE+PQ Sbjct: 561 HRGEAMGLARELAAKNVLSEDSLKRLNRTFPMLNLYKEIPQ 601 >ref|XP_020079888.1| pentatricopeptide repeat-containing protein At3g04760, chloroplastic-like isoform X1 [Ananas comosus] Length = 604 Score = 63.2 bits (152), Expect = 5e-09 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +1 Query: 1 HRAEAMELARELVGKDVFMEGSIRRLNKTFPMLNLYKEMPQ 123 HR EAM LAREL K+V E S++RLN+TFPMLNLYKE+PQ Sbjct: 562 HRGEAMGLARELAAKNVLSEDSLKRLNRTFPMLNLYKEIPQ 602 >gb|OAY67414.1| Pentatricopeptide repeat-containing protein, chloroplastic [Ananas comosus] Length = 487 Score = 61.6 bits (148), Expect = 2e-08 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +1 Query: 1 HRAEAMELARELVGKDVFMEGSIRRLNKTFPMLNLYKEMPQ 123 HR EAM LAREL K V E S++RLN+TFPMLNLYKE+PQ Sbjct: 445 HRGEAMGLARELAAKIVLSEDSLKRLNRTFPMLNLYKEIPQ 485 >ref|XP_018675412.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, chloroplastic-like [Musa acuminata subsp. malaccensis] ref|XP_018675413.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, chloroplastic-like [Musa acuminata subsp. malaccensis] Length = 607 Score = 60.5 bits (145), Expect = 5e-08 Identities = 26/44 (59%), Positives = 38/44 (86%) Frame = +1 Query: 1 HRAEAMELARELVGKDVFMEGSIRRLNKTFPMLNLYKEMPQPDD 132 H+AEAMELA++L ++VF E S++RLN+ FP+L+L+KE+PQP D Sbjct: 564 HKAEAMELAKDLAMRNVFSEDSLKRLNQNFPILDLFKEIPQPVD 607