BLASTX nr result
ID: Ophiopogon24_contig00000596
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00000596 (474 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020580830.1| ATP synthase subunit epsilon, mitochondrial ... 60 3e-09 ref|XP_020267054.1| uncharacterized protein LOC109842611 [Aspara... 62 6e-09 ref|XP_016718551.1| PREDICTED: ATP synthase subunit epsilon, mit... 59 7e-09 ref|XP_022774862.1| ATP synthase subunit epsilon, mitochondrial ... 59 1e-08 ref|XP_012489332.1| PREDICTED: ATP synthase subunit epsilon, mit... 59 1e-08 ref|XP_016680667.1| PREDICTED: ATP synthase subunit epsilon, mit... 59 1e-08 ref|XP_016718083.1| PREDICTED: ATP synthase subunit epsilon, mit... 58 3e-08 ref|XP_012435788.1| PREDICTED: ATP synthase subunit epsilon, mit... 58 3e-08 ref|XP_008789701.1| PREDICTED: ATP synthase subunit epsilon, mit... 58 3e-08 ref|XP_023761996.1| ATP synthase subunit epsilon, mitochondrial ... 57 5e-08 ref|XP_021275198.1| ATP synthase subunit epsilon, mitochondrial ... 57 5e-08 emb|CDP06893.1| unnamed protein product [Coffea canephora] 57 5e-08 ref|XP_007048281.2| PREDICTED: ATP synthase subunit epsilon, mit... 57 5e-08 ref|XP_010928624.1| PREDICTED: ATP synthase subunit epsilon, mit... 57 6e-08 ref|XP_022741939.1| ATP synthase subunit epsilon, mitochondrial ... 57 7e-08 gb|PKU77221.1| ATP synthase subunit epsilon, mitochondrial [Dend... 57 8e-08 ref|XP_020693584.1| ATP synthase subunit epsilon, mitochondrial-... 57 8e-08 ref|XP_017638323.1| PREDICTED: ATP synthase subunit epsilon, mit... 56 1e-07 ref|XP_020109976.1| ATP synthase subunit epsilon, mitochondrial-... 56 1e-07 ref|XP_010913615.1| PREDICTED: ATP synthase subunit epsilon, mit... 57 1e-07 >ref|XP_020580830.1| ATP synthase subunit epsilon, mitochondrial [Phalaenopsis equestris] Length = 70 Score = 60.1 bits (144), Expect = 3e-09 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +3 Query: 33 QNGAAAREKVHFSVSKWTAGKPEKPTVRTDSPDE 134 ++ AA+REKVHF+VSKW GKPEKPT+RTDSPD+ Sbjct: 37 KSDAASREKVHFAVSKWANGKPEKPTIRTDSPDQ 70 >ref|XP_020267054.1| uncharacterized protein LOC109842611 [Asparagus officinalis] Length = 155 Score = 61.6 bits (148), Expect = 6e-09 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 42 AAAREKVHFSVSKWTAGKPEKPTVRTDSPDE 134 +A+REKVHFSVSKW GKPEKPT+RTDSPDE Sbjct: 125 SASREKVHFSVSKWAGGKPEKPTIRTDSPDE 155 >ref|XP_016718551.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial-like isoform X2 [Gossypium hirsutum] ref|XP_017634980.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial [Gossypium arboreum] gb|KHG00299.1| hypothetical protein F383_19415 [Gossypium arboreum] Length = 70 Score = 59.3 bits (142), Expect = 7e-09 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 42 AAAREKVHFSVSKWTAGKPEKPTVRTDSPDE 134 A +REKVHFS+SKWT GKPEKPT+RTDSP+E Sbjct: 40 ALSREKVHFSISKWTDGKPEKPTLRTDSPEE 70 >ref|XP_022774862.1| ATP synthase subunit epsilon, mitochondrial [Durio zibethinus] Length = 70 Score = 58.5 bits (140), Expect = 1e-08 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +3 Query: 42 AAAREKVHFSVSKWTAGKPEKPTVRTDSPDE 134 A REKVHFS+SKWT GKPEKPT+R+DSP+E Sbjct: 40 ALTREKVHFSISKWTEGKPEKPTIRSDSPEE 70 >ref|XP_012489332.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial [Gossypium raimondii] ref|XP_016695029.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial [Gossypium hirsutum] gb|KJB40448.1| hypothetical protein B456_007G063900 [Gossypium raimondii] Length = 70 Score = 58.5 bits (140), Expect = 1e-08 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +3 Query: 42 AAAREKVHFSVSKWTAGKPEKPTVRTDSPDE 134 A +REKVHFS+SKWT GKPEKPT+R+DSP+E Sbjct: 40 ALSREKVHFSISKWTDGKPEKPTIRSDSPEE 70 >ref|XP_016680667.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial-like [Gossypium hirsutum] ref|XP_016680693.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial-like [Gossypium hirsutum] gb|ACS83605.1| ATP synthase epsilon subunit 1 [Gossypium hirsutum] Length = 70 Score = 58.5 bits (140), Expect = 1e-08 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +3 Query: 42 AAAREKVHFSVSKWTAGKPEKPTVRTDSPDE 134 A +REKVHFS+SKWT GKPEKPT+R+DSP+E Sbjct: 40 ALSREKVHFSISKWTDGKPEKPTIRSDSPEE 70 >ref|XP_016718083.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial [Gossypium hirsutum] Length = 70 Score = 57.8 bits (138), Expect = 3e-08 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +3 Query: 42 AAAREKVHFSVSKWTAGKPEKPTVRTDSPDE 134 A +REKVHFS+SKWT GKPEKPT+R+DSP+E Sbjct: 40 ALSREKVHFSISKWTDGKPEKPTLRSDSPEE 70 >ref|XP_012435788.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial-like isoform X2 [Gossypium raimondii] gb|KJB46881.1| hypothetical protein B456_008G000800 [Gossypium raimondii] Length = 70 Score = 57.8 bits (138), Expect = 3e-08 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +3 Query: 42 AAAREKVHFSVSKWTAGKPEKPTVRTDSPDE 134 A +REKVHFS+SKWT GKPEKPT+R+DSP+E Sbjct: 40 ALSREKVHFSISKWTDGKPEKPTLRSDSPEE 70 >ref|XP_008789701.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial-like [Phoenix dactylifera] Length = 75 Score = 57.8 bits (138), Expect = 3e-08 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +3 Query: 42 AAAREKVHFSVSKWTAGKPEKPTVRTDSPDE 134 AA+REKVHF++SKW GKPEKPTVR+DSP+E Sbjct: 45 AASREKVHFAISKWADGKPEKPTVRSDSPEE 75 >ref|XP_023761996.1| ATP synthase subunit epsilon, mitochondrial [Lactuca sativa] Length = 70 Score = 57.0 bits (136), Expect = 5e-08 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +3 Query: 42 AAAREKVHFSVSKWTAGKPEKPTVRTDSPDE 134 A +REKVHFS +KWT GKPEKPT+R+DSPDE Sbjct: 40 AISREKVHFSSTKWTDGKPEKPTIRSDSPDE 70 >ref|XP_021275198.1| ATP synthase subunit epsilon, mitochondrial [Herrania umbratica] Length = 70 Score = 57.0 bits (136), Expect = 5e-08 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +3 Query: 42 AAAREKVHFSVSKWTAGKPEKPTVRTDSPDE 134 A AREKVHFS+SKWT GKPEKPT+R+DSP E Sbjct: 40 ALAREKVHFSISKWTNGKPEKPTLRSDSPVE 70 >emb|CDP06893.1| unnamed protein product [Coffea canephora] Length = 70 Score = 57.0 bits (136), Expect = 5e-08 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +3 Query: 30 RQNGAAAREKVHFSVSKWTAGKPEKPTVRTDSPDE 134 R+ A REKVHFSVSKW GKPEKPT+R+D+P+E Sbjct: 36 RRTEALTREKVHFSVSKWVDGKPEKPTIRSDTPEE 70 >ref|XP_007048281.2| PREDICTED: ATP synthase subunit epsilon, mitochondrial [Theobroma cacao] gb|EOX92439.1| ATP synthase epsilon chain, mitochondrial isoform 1 [Theobroma cacao] Length = 70 Score = 57.0 bits (136), Expect = 5e-08 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +3 Query: 42 AAAREKVHFSVSKWTAGKPEKPTVRTDSPDE 134 A AREKVHFS+SKWT GKPEKPT+R+DSP E Sbjct: 40 ALAREKVHFSISKWTDGKPEKPTLRSDSPVE 70 >ref|XP_010928624.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial-like [Elaeis guineensis] Length = 75 Score = 57.0 bits (136), Expect = 6e-08 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +3 Query: 42 AAAREKVHFSVSKWTAGKPEKPTVRTDSPDE 134 AA REKVHF++SKW GKPEKPT+R+DSP+E Sbjct: 45 AATREKVHFAISKWANGKPEKPTIRSDSPEE 75 >ref|XP_022741939.1| ATP synthase subunit epsilon, mitochondrial [Durio zibethinus] Length = 70 Score = 56.6 bits (135), Expect = 7e-08 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +3 Query: 42 AAAREKVHFSVSKWTAGKPEKPTVRTDSPDE 134 A +REKVHFS+SKWT GKPEKP +R+DSP+E Sbjct: 40 ALSREKVHFSISKWTDGKPEKPAIRSDSPEE 70 >gb|PKU77221.1| ATP synthase subunit epsilon, mitochondrial [Dendrobium catenatum] Length = 75 Score = 56.6 bits (135), Expect = 8e-08 Identities = 22/31 (70%), Positives = 30/31 (96%) Frame = +3 Query: 42 AAAREKVHFSVSKWTAGKPEKPTVRTDSPDE 134 AA+REKVHF+V+KW +GKPEKPT+R+DSP++ Sbjct: 45 AASREKVHFAVTKWVSGKPEKPTIRSDSPED 75 >ref|XP_020693584.1| ATP synthase subunit epsilon, mitochondrial-like [Dendrobium catenatum] Length = 75 Score = 56.6 bits (135), Expect = 8e-08 Identities = 22/31 (70%), Positives = 30/31 (96%) Frame = +3 Query: 42 AAAREKVHFSVSKWTAGKPEKPTVRTDSPDE 134 AA+REKVHF+V+KW +GKPEKPT+R+DSP++ Sbjct: 45 AASREKVHFAVTKWVSGKPEKPTIRSDSPED 75 >ref|XP_017638323.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial-like [Gossypium arboreum] gb|KHG05542.1| ATP synthase subunit epsilon, mitochondrial [Gossypium arboreum] Length = 70 Score = 56.2 bits (134), Expect = 1e-07 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +3 Query: 42 AAAREKVHFSVSKWTAGKPEKPTVRTDSPDE 134 A +REKVHFS+SKWT G PEKPT+R+DSP+E Sbjct: 40 ALSREKVHFSISKWTDGTPEKPTIRSDSPEE 70 >ref|XP_020109976.1| ATP synthase subunit epsilon, mitochondrial-like [Ananas comosus] Length = 78 Score = 56.2 bits (134), Expect = 1e-07 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +3 Query: 42 AAAREKVHFSVSKWTAGKPEKPTVRTDSPDE 134 A +REKVHF++SKW GKPEKPT+R+DSP+E Sbjct: 48 ATSREKVHFAISKWAEGKPEKPTIRSDSPEE 78 >ref|XP_010913615.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial-like [Elaeis guineensis] Length = 107 Score = 57.0 bits (136), Expect = 1e-07 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +3 Query: 42 AAAREKVHFSVSKWTAGKPEKPTVRTDSPDE 134 AA REKVHF++SKW GKPEKPT+R+DSP+E Sbjct: 77 AATREKVHFAISKWADGKPEKPTIRSDSPEE 107