BLASTX nr result
ID: Ophiopogon24_contig00000183
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00000183 (373 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P00225.1|FER_LEULE RecName: Full=Ferredoxin 63 2e-10 ref|WP_079865848.1| ferredoxin [Acinetobacter baumannii] 62 2e-10 ref|XP_020248634.1| LOW QUALITY PROTEIN: ferredoxin-like [Aspara... 64 3e-10 gb|OVA05216.1| 2Fe-2S ferredoxin-type domain [Macleaya cordata] 62 3e-10 sp|P81373.1|FERB_ALOMA RecName: Full=Ferredoxin-B; Short=Fd B >g... 62 3e-10 ref|XP_022984878.1| ferredoxin-A-like [Cucurbita maxima] 64 4e-10 sp|P83522.1|FER_HORVU RecName: Full=Ferredoxin 62 5e-10 prf||1802399A ferredoxin [Hordeum vulgare] 62 5e-10 ref|XP_020697585.1| ferredoxin-like [Dendrobium catenatum] >gi|1... 63 5e-10 ref|XP_018835527.1| PREDICTED: ferredoxin-like [Juglans regia] 63 5e-10 ref|XP_022922723.1| ferredoxin-A-like [Cucurbita moschata] 63 7e-10 ref|XP_018842031.1| PREDICTED: ferredoxin-A-like [Juglans regia] 62 1e-09 ref|XP_021665380.1| ferredoxin-like [Hevea brasiliensis] 62 1e-09 dbj|BAJ91647.1| predicted protein, partial [Hordeum vulgare subs... 61 1e-09 gb|OVA14383.1| 2Fe-2S ferredoxin-type domain [Macleaya cordata] 62 1e-09 ref|XP_022136608.1| ferredoxin [Momordica charantia] 62 1e-09 sp|P00226.1|FER_SAMNI RecName: Full=Ferredoxin >gi|223163|prf||0... 60 2e-09 gb|PKI53034.1| hypothetical protein CRG98_026614 [Punica granatum] 60 2e-09 ref|XP_020211608.1| ferredoxin-like [Cajanus cajan] >gi|10123656... 62 2e-09 ref|XP_010030127.1| PREDICTED: ferredoxin [Eucalyptus grandis] 62 2e-09 >sp|P00225.1|FER_LEULE RecName: Full=Ferredoxin Length = 96 Score = 62.8 bits (151), Expect = 2e-10 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -3 Query: 371 LDDDQINEGWVLTCYAYPRSNVVIETHKEEEL 276 LDD+QI EGWVLTC AYPRS+VVIETHKEEEL Sbjct: 63 LDDEQIEEGWVLTCAAYPRSDVVIETHKEEEL 94 >ref|WP_079865848.1| ferredoxin [Acinetobacter baumannii] Length = 84 Score = 62.4 bits (150), Expect = 2e-10 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 371 LDDDQINEGWVLTCYAYPRSNVVIETHKEEEL 276 LDDDQ+ EGWVLTC+AYP S+VVIETHKEEEL Sbjct: 51 LDDDQVAEGWVLTCHAYPTSDVVIETHKEEEL 82 >ref|XP_020248634.1| LOW QUALITY PROTEIN: ferredoxin-like [Asparagus officinalis] Length = 141 Score = 63.5 bits (153), Expect = 3e-10 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -3 Query: 371 LDDDQINEGWVLTCYAYPRSNVVIETHKEEELA 273 LDD+Q++ GWVLTCYAYPRS++VIETHKEEELA Sbjct: 109 LDDEQMDAGWVLTCYAYPRSDLVIETHKEEELA 141 >gb|OVA05216.1| 2Fe-2S ferredoxin-type domain [Macleaya cordata] Length = 98 Score = 62.4 bits (150), Expect = 3e-10 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 371 LDDDQINEGWVLTCYAYPRSNVVIETHKEEEL 276 LDDDQ++EGWVLTC AYP+S+VVIETHKEEEL Sbjct: 65 LDDDQMDEGWVLTCVAYPQSDVVIETHKEEEL 96 >sp|P81373.1|FERB_ALOMA RecName: Full=Ferredoxin-B; Short=Fd B gb|AAB25191.1| ferredoxin B isoprotein, Fd B [Alocasia macrorrhiza=elephant ear, Schott, Peptide, 98 aa] Length = 98 Score = 62.4 bits (150), Expect = 3e-10 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 371 LDDDQINEGWVLTCYAYPRSNVVIETHKEEEL 276 LDDDQI EGWVLTC AYP S+VVIETHKEEEL Sbjct: 65 LDDDQIGEGWVLTCVAYPTSDVVIETHKEEEL 96 >ref|XP_022984878.1| ferredoxin-A-like [Cucurbita maxima] Length = 147 Score = 63.5 bits (153), Expect = 4e-10 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 371 LDDDQINEGWVLTCYAYPRSNVVIETHKEEEL 276 LDDDQI +GWVLTC AYP+SN+VIETHKEEEL Sbjct: 114 LDDDQIEDGWVLTCVAYPQSNIVIETHKEEEL 145 >sp|P83522.1|FER_HORVU RecName: Full=Ferredoxin Length = 97 Score = 62.0 bits (149), Expect = 5e-10 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 371 LDDDQINEGWVLTCYAYPRSNVVIETHKEEEL 276 LDDDQ+ EGWVLTC AYP+S+VVIETHKEEEL Sbjct: 64 LDDDQMEEGWVLTCAAYPKSDVVIETHKEEEL 95 >prf||1802399A ferredoxin [Hordeum vulgare] Length = 97 Score = 62.0 bits (149), Expect = 5e-10 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 371 LDDDQINEGWVLTCYAYPRSNVVIETHKEEEL 276 LDDDQ+ EGWVLTC AYP+S+VVIETHKEEEL Sbjct: 64 LDDDQMEEGWVLTCAAYPKSDVVIETHKEEEL 95 >ref|XP_020697585.1| ferredoxin-like [Dendrobium catenatum] gb|PKU66215.1| Ferredoxin, chloroplastic [Dendrobium catenatum] Length = 146 Score = 63.2 bits (152), Expect = 5e-10 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 371 LDDDQINEGWVLTCYAYPRSNVVIETHKEEELA 273 LDDDQI+EGWVLTCYAYP+S+V I+TH EEELA Sbjct: 114 LDDDQISEGWVLTCYAYPKSDVTIKTHMEEELA 146 >ref|XP_018835527.1| PREDICTED: ferredoxin-like [Juglans regia] Length = 146 Score = 63.2 bits (152), Expect = 5e-10 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 371 LDDDQINEGWVLTCYAYPRSNVVIETHKEEEL 276 LDDDQ+ +GWVLTC AYP+SNVVIETHKEEEL Sbjct: 113 LDDDQLGDGWVLTCVAYPQSNVVIETHKEEEL 144 >ref|XP_022922723.1| ferredoxin-A-like [Cucurbita moschata] Length = 147 Score = 62.8 bits (151), Expect = 7e-10 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 371 LDDDQINEGWVLTCYAYPRSNVVIETHKEEEL 276 LDDDQI +GWVLTC AYP+SNVVI+THKEEEL Sbjct: 114 LDDDQIEDGWVLTCVAYPQSNVVIQTHKEEEL 145 >ref|XP_018842031.1| PREDICTED: ferredoxin-A-like [Juglans regia] Length = 145 Score = 62.4 bits (150), Expect = 1e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 371 LDDDQINEGWVLTCYAYPRSNVVIETHKEEEL 276 LDDDQ++ GWVLTC AYP+SNVVIETHKEEEL Sbjct: 112 LDDDQVDGGWVLTCVAYPQSNVVIETHKEEEL 143 >ref|XP_021665380.1| ferredoxin-like [Hevea brasiliensis] Length = 146 Score = 62.4 bits (150), Expect = 1e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 371 LDDDQINEGWVLTCYAYPRSNVVIETHKEEELA 273 LDDDQI+ GWVLTC AYP+S++VIETHKEEELA Sbjct: 113 LDDDQIDAGWVLTCVAYPQSDIVIETHKEEELA 145 >dbj|BAJ91647.1| predicted protein, partial [Hordeum vulgare subsp. vulgare] Length = 91 Score = 60.8 bits (146), Expect = 1e-09 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -3 Query: 371 LDDDQINEGWVLTCYAYPRSNVVIETHKEEEL 276 LDDDQ+ GWVLTC+AYP+S++VIETHKEEEL Sbjct: 58 LDDDQMEAGWVLTCHAYPKSDIVIETHKEEEL 89 >gb|OVA14383.1| 2Fe-2S ferredoxin-type domain [Macleaya cordata] Length = 143 Score = 62.0 bits (149), Expect = 1e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 371 LDDDQINEGWVLTCYAYPRSNVVIETHKEEEL 276 LDDDQ+ EGWVLTC AYP+S+VVIETHKEEEL Sbjct: 110 LDDDQMEEGWVLTCVAYPQSDVVIETHKEEEL 141 >ref|XP_022136608.1| ferredoxin [Momordica charantia] Length = 147 Score = 62.0 bits (149), Expect = 1e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 371 LDDDQINEGWVLTCYAYPRSNVVIETHKEEEL 276 LDDDQ+ EGWVLTC AYP+S++VIETHKEEEL Sbjct: 114 LDDDQLEEGWVLTCVAYPQSDIVIETHKEEEL 145 >sp|P00226.1|FER_SAMNI RecName: Full=Ferredoxin prf||0601253A ferredoxin Length = 97 Score = 60.5 bits (145), Expect = 2e-09 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 371 LDDDQINEGWVLTCYAYPRSNVVIETHKEEEL 276 LDD+QI EGWVLTC AYP+S+V IETHKEEEL Sbjct: 64 LDDEQIEEGWVLTCVAYPKSDVTIETHKEEEL 95 >gb|PKI53034.1| hypothetical protein CRG98_026614 [Punica granatum] Length = 98 Score = 60.5 bits (145), Expect = 2e-09 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -3 Query: 371 LDDDQINEGWVLTCYAYPRSNVVIETHKEEEL 276 LDDDQI EGWVLTC AYP +VVIETHKEEEL Sbjct: 65 LDDDQIEEGWVLTCVAYPLGDVVIETHKEEEL 96 >ref|XP_020211608.1| ferredoxin-like [Cajanus cajan] gb|KYP76813.1| hypothetical protein KK1_021070 [Cajanus cajan] Length = 146 Score = 61.6 bits (148), Expect = 2e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 371 LDDDQINEGWVLTCYAYPRSNVVIETHKEEEL 276 LDD+QIN GWVLTC A PRSNVVIETHKEEEL Sbjct: 114 LDDEQINGGWVLTCVAQPRSNVVIETHKEEEL 145 >ref|XP_010030127.1| PREDICTED: ferredoxin [Eucalyptus grandis] Length = 146 Score = 61.6 bits (148), Expect = 2e-09 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -3 Query: 371 LDDDQINEGWVLTCYAYPRSNVVIETHKEEEL 276 LDDDQI EGWVLTC AYP+S V IETHKEEEL Sbjct: 113 LDDDQIEEGWVLTCVAYPKSEVTIETHKEEEL 144