BLASTX nr result
ID: Ophiopogon23_contig00042561
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00042561 (404 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX67372.1| cellular nucleic acid-binding protein, partial [T... 53 2e-06 emb|CCA29197.1| gag-pol polyprotein, partial [Small ruminant len... 54 6e-06 ref|XP_019703179.1| PREDICTED: uncharacterized protein LOC109505... 54 8e-06 >gb|PNX67372.1| cellular nucleic acid-binding protein, partial [Trifolium pratense] Length = 79 Score = 52.8 bits (125), Expect = 2e-06 Identities = 18/34 (52%), Positives = 25/34 (73%) Frame = -1 Query: 404 CFKCGDRGHMAKFCRNGVLCFNCRKVGHYAYTCR 303 C+KCGD GH A C+ GV+CFNC++ GH + C+ Sbjct: 37 CYKCGDPGHKADQCKKGVICFNCKEPGHKSNVCK 70 >emb|CCA29197.1| gag-pol polyprotein, partial [Small ruminant lentivirus] Length = 217 Score = 53.9 bits (128), Expect = 6e-06 Identities = 19/36 (52%), Positives = 25/36 (69%) Frame = -1 Query: 404 CFKCGDRGHMAKFCRNGVLCFNCRKVGHYAYTCRHQ 297 C+ CG GHMA+ CRNG++C NC K GH CR++ Sbjct: 180 CYNCGKEGHMARQCRNGIICHNCGKRGHIQKNCRNK 215 >ref|XP_019703179.1| PREDICTED: uncharacterized protein LOC109505220 [Elaeis guineensis] Length = 251 Score = 53.9 bits (128), Expect = 8e-06 Identities = 20/33 (60%), Positives = 25/33 (75%) Frame = -1 Query: 404 CFKCGDRGHMAKFCRNGVLCFNCRKVGHYAYTC 306 CF+CG RGH + CRNGV+CF CR +GH + TC Sbjct: 137 CFRCGGRGHYWRECRNGVVCFICRGIGHSSCTC 169