BLASTX nr result
ID: Ophiopogon23_contig00042276
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00042276 (393 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009395506.2| PREDICTED: protein trichome birefringence-li... 56 2e-06 ref|XP_015946351.1| protein trichome birefringence-like 19 [Arac... 56 2e-06 ref|XP_020970617.1| protein trichome birefringence-like 19 isofo... 55 4e-06 ref|XP_016178818.1| protein trichome birefringence-like 19 isofo... 55 4e-06 ref|NP_001143774.1| uncharacterized protein LOC100276538 [Zea ma... 55 5e-06 gb|ACF88461.1| unknown [Zea mays] >gi|1142637262|gb|ONM06325.1| ... 55 5e-06 ref|XP_009395269.1| PREDICTED: protein trichome birefringence-li... 54 7e-06 >ref|XP_009395506.2| PREDICTED: protein trichome birefringence-like 19 [Musa acuminata subsp. malaccensis] Length = 431 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/24 (91%), Positives = 23/24 (95%) Frame = +2 Query: 320 DIFRGEWVPNPNAPYYTNETCRVI 391 DIFRGEWVPNPNAPYYTNE+CR I Sbjct: 86 DIFRGEWVPNPNAPYYTNESCRAI 109 >ref|XP_015946351.1| protein trichome birefringence-like 19 [Arachis duranensis] Length = 433 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/46 (54%), Positives = 28/46 (60%) Frame = +2 Query: 254 ISPSPYATPYANGRTNVVYPGSDIFRGEWVPNPNAPYYTNETCRVI 391 I P+A Y + + DIFRGEWVPNP APYYTNETC I Sbjct: 53 IESKPHAHEYDESQASEYNNKCDIFRGEWVPNPEAPYYTNETCWAI 98 >ref|XP_020970617.1| protein trichome birefringence-like 19 isoform X1 [Arachis ipaensis] Length = 442 Score = 55.1 bits (131), Expect = 4e-06 Identities = 24/44 (54%), Positives = 27/44 (61%) Frame = +2 Query: 260 PSPYATPYANGRTNVVYPGSDIFRGEWVPNPNAPYYTNETCRVI 391 P P+ Y + + DIFRGEWVPNP APYYTNETC I Sbjct: 64 PHPHEYEYDESQASEYNNKCDIFRGEWVPNPEAPYYTNETCWAI 107 >ref|XP_016178818.1| protein trichome birefringence-like 19 isoform X2 [Arachis ipaensis] Length = 442 Score = 55.1 bits (131), Expect = 4e-06 Identities = 24/44 (54%), Positives = 27/44 (61%) Frame = +2 Query: 260 PSPYATPYANGRTNVVYPGSDIFRGEWVPNPNAPYYTNETCRVI 391 P P+ Y + + DIFRGEWVPNP APYYTNETC I Sbjct: 64 PHPHEYEYDESQASEYNNKCDIFRGEWVPNPEAPYYTNETCWAI 107 >ref|NP_001143774.1| uncharacterized protein LOC100276538 [Zea mays] gb|ACG35228.1| hypothetical protein [Zea mays] Length = 420 Score = 54.7 bits (130), Expect = 5e-06 Identities = 21/26 (80%), Positives = 25/26 (96%) Frame = +2 Query: 314 GSDIFRGEWVPNPNAPYYTNETCRVI 391 G DIFRGEWVP+P+APYYTN+TC+VI Sbjct: 75 GCDIFRGEWVPDPDAPYYTNDTCKVI 100 >gb|ACF88461.1| unknown [Zea mays] gb|ONM06325.1| TRICHOME BIREFRINGENCE-LIKE 20 [Zea mays] Length = 420 Score = 54.7 bits (130), Expect = 5e-06 Identities = 21/26 (80%), Positives = 25/26 (96%) Frame = +2 Query: 314 GSDIFRGEWVPNPNAPYYTNETCRVI 391 G DIFRGEWVP+P+APYYTN+TC+VI Sbjct: 75 GCDIFRGEWVPDPDAPYYTNDTCKVI 100 >ref|XP_009395269.1| PREDICTED: protein trichome birefringence-like 19 [Musa acuminata subsp. malaccensis] Length = 471 Score = 54.3 bits (129), Expect = 7e-06 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = +2 Query: 320 DIFRGEWVPNPNAPYYTNETCRVI 391 DIFRGEWVPNPNAPYYTNETC I Sbjct: 109 DIFRGEWVPNPNAPYYTNETCWAI 132