BLASTX nr result
ID: Ophiopogon23_contig00042244
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00042244 (441 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008775170.1| PREDICTED: ethylene-responsive transcription... 61 2e-08 ref|XP_008810659.1| PREDICTED: ethylene-responsive transcription... 55 5e-06 ref|XP_010910974.1| PREDICTED: ethylene-responsive transcription... 54 9e-06 >ref|XP_008775170.1| PREDICTED: ethylene-responsive transcription factor TINY-like [Phoenix dactylifera] Length = 226 Score = 61.2 bits (147), Expect = 2e-08 Identities = 34/51 (66%), Positives = 37/51 (72%), Gaps = 1/51 (1%) Frame = -1 Query: 339 DQLGEIVELPRLNGGLFNWEEFGG-EFVCCDLVDTLAAYRPPWMEEADEYQ 190 D+LGEIVELPRL G F+ E GG EFV DL D L AY PPWME ADEY+ Sbjct: 149 DELGEIVELPRLGEGFFDSAESGGGEFVLHDLPD-LWAYSPPWMEGADEYE 198 >ref|XP_008810659.1| PREDICTED: ethylene-responsive transcription factor TINY-like [Phoenix dactylifera] Length = 226 Score = 54.7 bits (130), Expect = 5e-06 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 1/50 (2%) Frame = -1 Query: 339 DQLGEIVELPRLNGGLFNWEEFGG-EFVCCDLVDTLAAYRPPWMEEADEY 193 D+LGEIVELPRL GLF+ E GG +FV D D AY PPWM ADEY Sbjct: 149 DELGEIVELPRLEEGLFDSAESGGRDFVLHDSPDPW-AYSPPWMAGADEY 197 >ref|XP_010910974.1| PREDICTED: ethylene-responsive transcription factor TINY-like [Elaeis guineensis] Length = 226 Score = 53.9 bits (128), Expect = 9e-06 Identities = 31/49 (63%), Positives = 33/49 (67%), Gaps = 1/49 (2%) Frame = -1 Query: 339 DQLGEIVELPRLNGGLF-NWEEFGGEFVCCDLVDTLAAYRPPWMEEADE 196 D+LGEIVELPRL G F + E GGEFV D D L Y PPWME ADE Sbjct: 149 DELGEIVELPRLGEGFFHSAESGGGEFVLHDSPD-LWVYSPPWMEGADE 196