BLASTX nr result
ID: Ophiopogon23_contig00042190
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00042190 (490 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020600229.1| glucan endo-1,3-beta-glucosidase 14-like [Ph... 57 2e-06 ref|XP_020693316.1| glucan endo-1,3-beta-glucosidase 14-like [De... 55 6e-06 >ref|XP_020600229.1| glucan endo-1,3-beta-glucosidase 14-like [Phalaenopsis equestris] Length = 386 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/38 (78%), Positives = 32/38 (84%), Gaps = 1/38 (2%) Frame = -3 Query: 488 GPTSERNYGLFYPNGTLVYNIGLQNAGQHFLSG-SPSA 378 GPTSERNYGLFYPNGT VYNIGLQ +G LSG SPS+ Sbjct: 324 GPTSERNYGLFYPNGTPVYNIGLQGSG---LSGFSPSS 358 >ref|XP_020693316.1| glucan endo-1,3-beta-glucosidase 14-like [Dendrobium catenatum] gb|PKU64356.1| Glucan endo-1,3-beta-glucosidase 14 [Dendrobium catenatum] Length = 389 Score = 55.5 bits (132), Expect = 6e-06 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = -3 Query: 488 GPTSERNYGLFYPNGTLVYNIGLQNAGQHFLSGSPSAK 375 GPTSERNYGLFYP+GT VYNIGL+ +S SP++K Sbjct: 327 GPTSERNYGLFYPDGTPVYNIGLKTGHLSGISNSPASK 364