BLASTX nr result
ID: Ophiopogon23_contig00041995
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00041995 (396 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020252607.1| dirigent protein 10-like [Asparagus officina... 105 2e-25 >ref|XP_020252607.1| dirigent protein 10-like [Asparagus officinalis] Length = 209 Score = 105 bits (261), Expect = 2e-25 Identities = 56/115 (48%), Positives = 70/115 (60%), Gaps = 1/115 (0%) Frame = +1 Query: 40 MHNLTSLLFAILAIIYPPTFARPLKNTNQFITFFIDDVFEHASP-SLPATENIGQFPFSE 216 M NL LL +IL I PP FARPLK T+ FITFF +++FE++ P S P T N G+ PF Sbjct: 3 MENLPFLLLSILTITCPPVFARPLKKTDNFITFFTNNMFENSIPFSTPMTNNNGKTPF-- 60 Query: 217 PRDLFHVNNGMPTANPKGHAHGFSGRPGASAGWLPFLTSLQALELGNVSVIEEEL 381 FH N PKG FS R GWL +T++Q LE+GN++VIEEEL Sbjct: 61 ----FHTNGDKARGKPKGRVRSFSSRGEIPLGWLSVITNVQTLEIGNMTVIEEEL 111