BLASTX nr result
ID: Ophiopogon23_contig00041685
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00041685 (795 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY64636.1| hypothetical protein LSAT_6X24740 [Lactuca sativa] 101 7e-22 ref|XP_010696289.1| PREDICTED: probable xyloglucan endotransgluc... 101 1e-21 emb|CAA48325.1| cellulase, partial [Tropaeolum majus] 99 1e-21 ref|XP_023746017.1| probable xyloglucan endotransglucosylase/hyd... 101 1e-21 pdb|2UWC|A Chain A, Crystal Structure Of Nasturtium Xyloglucan H... 100 2e-21 gb|PNX94628.1| xyloglucan endotransglucosylase/hydrolase, partia... 96 3e-21 ref|XP_021627577.1| xyloglucan endotransglucosylase/hydrolase pr... 100 3e-21 ref|XP_011089954.1| probable xyloglucan endotransglucosylase/hyd... 100 5e-21 pdb|2UWB|A Chain A, Crystal Structure Of The Nasturtium Seedling... 99 6e-21 pdb|2UWA|A Chain A, Crystal Structure Of The Nasturtium Seedling... 99 7e-21 ref|XP_022000865.1| probable xyloglucan endotransglucosylase/hyd... 99 7e-21 gb|KDO39060.1| hypothetical protein CISIN_1g043947mg, partial [C... 97 8e-21 gb|PPD91467.1| hypothetical protein GOBAR_DD11611 [Gossypium bar... 99 9e-21 pdb|2VH9|A Chain A, Crystal Structure Of Nxg1-deltayniig In Comp... 99 9e-21 ref|XP_022883637.1| probable xyloglucan endotransglucosylase/hyd... 99 9e-21 ref|XP_010535628.1| PREDICTED: xyloglucan endotransglucosylase/h... 99 9e-21 ref|XP_009394629.1| PREDICTED: probable xyloglucan endotransgluc... 99 9e-21 emb|CAA48324.1| cellulase [Tropaeolum majus] 99 1e-20 emb|CBI30149.3| unnamed protein product, partial [Vitis vinifera] 98 1e-20 ref|XP_022144717.1| probable xyloglucan endotransglucosylase/hyd... 99 1e-20 >gb|PLY64636.1| hypothetical protein LSAT_6X24740 [Lactuca sativa] Length = 259 Score = 101 bits (251), Expect = 7e-22 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = +2 Query: 644 FFVDDIPIRQYLRKSSATFPLRPMWLYGSIWDASDWATENGRYRADYRYQ 793 FFVDD+PIR+Y RKSSATFPLRPMWLYGSIWDAS WATE+G+Y+ADYRYQ Sbjct: 139 FFVDDVPIRRYPRKSSATFPLRPMWLYGSIWDASSWATEDGKYKADYRYQ 188 >ref|XP_010696289.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 32 [Beta vulgaris subsp. vulgaris] gb|KMS97036.1| hypothetical protein BVRB_7g178970 [Beta vulgaris subsp. vulgaris] Length = 299 Score = 101 bits (252), Expect = 1e-21 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = +2 Query: 644 FFVDDIPIRQYLRKSSATFPLRPMWLYGSIWDASDWATENGRYRADYRYQ 793 F VDDIPIR+YL+KS+ATFPLRPMWLYGSIWDAS WATENG+Y+ADYRYQ Sbjct: 177 FLVDDIPIRRYLKKSAATFPLRPMWLYGSIWDASSWATENGKYKADYRYQ 226 >emb|CAA48325.1| cellulase, partial [Tropaeolum majus] Length = 190 Score = 99.0 bits (245), Expect = 1e-21 Identities = 40/50 (80%), Positives = 47/50 (94%) Frame = +2 Query: 644 FFVDDIPIRQYLRKSSATFPLRPMWLYGSIWDASDWATENGRYRADYRYQ 793 FFVDD+PIR+Y RKS ATFPLRP+W+YGS+WDAS WATENG+Y+ADYRYQ Sbjct: 74 FFVDDVPIRRYPRKSDATFPLRPLWVYGSVWDASSWATENGKYKADYRYQ 123 >ref|XP_023746017.1| probable xyloglucan endotransglucosylase/hydrolase protein 32 [Lactuca sativa] Length = 297 Score = 101 bits (251), Expect = 1e-21 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = +2 Query: 644 FFVDDIPIRQYLRKSSATFPLRPMWLYGSIWDASDWATENGRYRADYRYQ 793 FFVDD+PIR+Y RKSSATFPLRPMWLYGSIWDAS WATE+G+Y+ADYRYQ Sbjct: 177 FFVDDVPIRRYPRKSSATFPLRPMWLYGSIWDASSWATEDGKYKADYRYQ 226 >pdb|2UWC|A Chain A, Crystal Structure Of Nasturtium Xyloglucan Hydrolase Isoform Nxg2 pdb|2UWC|B Chain B, Crystal Structure Of Nasturtium Xyloglucan Hydrolase Isoform Nxg2 Length = 271 Score = 100 bits (248), Expect = 2e-21 Identities = 41/50 (82%), Positives = 47/50 (94%) Frame = +2 Query: 644 FFVDDIPIRQYLRKSSATFPLRPMWLYGSIWDASDWATENGRYRADYRYQ 793 FFVDD+PIR+Y RKS ATFPLRPMW+YGS+WDAS WATENG+Y+ADYRYQ Sbjct: 155 FFVDDVPIRRYPRKSDATFPLRPMWVYGSVWDASSWATENGKYKADYRYQ 204 >gb|PNX94628.1| xyloglucan endotransglucosylase/hydrolase, partial [Trifolium pratense] Length = 122 Score = 95.9 bits (237), Expect = 3e-21 Identities = 39/51 (76%), Positives = 46/51 (90%) Frame = +2 Query: 641 RFFVDDIPIRQYLRKSSATFPLRPMWLYGSIWDASDWATENGRYRADYRYQ 793 RF VDD+PIR+Y RKS TFP+RPMWLYGSIWDAS WATE+G+Y+ADY+YQ Sbjct: 1 RFLVDDVPIRRYPRKSDTTFPIRPMWLYGSIWDASSWATEDGKYKADYKYQ 51 >ref|XP_021627577.1| xyloglucan endotransglucosylase/hydrolase protein 31-like [Manihot esculenta] gb|OAY38086.1| hypothetical protein MANES_11G151500 [Manihot esculenta] Length = 291 Score = 100 bits (248), Expect = 3e-21 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = +2 Query: 644 FFVDDIPIRQYLRKSSATFPLRPMWLYGSIWDASDWATENGRYRADYRYQ 793 FFVDDIPIR+Y RKS ATFP+RPMW+YGSIWDAS WATENG+Y+ADYRYQ Sbjct: 175 FFVDDIPIRRYPRKSDATFPMRPMWVYGSIWDASSWATENGKYKADYRYQ 224 >ref|XP_011089954.1| probable xyloglucan endotransglucosylase/hydrolase protein 32 [Sesamum indicum] Length = 293 Score = 99.8 bits (247), Expect = 5e-21 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = +2 Query: 644 FFVDDIPIRQYLRKSSATFPLRPMWLYGSIWDASDWATENGRYRADYRYQ 793 FFVDD+PIR+Y RKS ATFPLRPMW+YGSIWDAS WATENGRY+ADY YQ Sbjct: 175 FFVDDVPIRRYPRKSDATFPLRPMWVYGSIWDASSWATENGRYKADYNYQ 224 >pdb|2UWB|A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig pdb|2UWB|B Chain B, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig Length = 267 Score = 99.0 bits (245), Expect = 6e-21 Identities = 40/50 (80%), Positives = 47/50 (94%) Frame = +2 Query: 644 FFVDDIPIRQYLRKSSATFPLRPMWLYGSIWDASDWATENGRYRADYRYQ 793 FFVDD+PIR+Y RKS ATFPLRP+W+YGS+WDAS WATENG+Y+ADYRYQ Sbjct: 151 FFVDDVPIRRYPRKSDATFPLRPLWVYGSVWDASSWATENGKYKADYRYQ 200 >pdb|2UWA|A Chain A, Crystal Structure Of The Nasturtium Seedling Xyloglucanase Isoform Nxg1 pdb|2UWA|B Chain B, Crystal Structure Of The Nasturtium Seedling Xyloglucanase Isoform Nxg1 pdb|2UWA|C Chain C, Crystal Structure Of The Nasturtium Seedling Xyloglucanase Isoform Nxg1 Length = 274 Score = 99.0 bits (245), Expect = 7e-21 Identities = 40/50 (80%), Positives = 47/50 (94%) Frame = +2 Query: 644 FFVDDIPIRQYLRKSSATFPLRPMWLYGSIWDASDWATENGRYRADYRYQ 793 FFVDD+PIR+Y RKS ATFPLRP+W+YGS+WDAS WATENG+Y+ADYRYQ Sbjct: 158 FFVDDVPIRRYPRKSDATFPLRPLWVYGSVWDASSWATENGKYKADYRYQ 207 >ref|XP_022000865.1| probable xyloglucan endotransglucosylase/hydrolase protein 32 [Helianthus annuus] gb|OTG01321.1| putative xyloglucan endotransglucosylase/hydrolase 32 [Helianthus annuus] Length = 297 Score = 99.4 bits (246), Expect = 7e-21 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = +2 Query: 644 FFVDDIPIRQYLRKSSATFPLRPMWLYGSIWDASDWATENGRYRADYRYQ 793 F VDD+PIR+Y RKS ATFPLRPMWLYGSIWDAS WAT+NGRY+ADYRYQ Sbjct: 177 FLVDDVPIRRYPRKSDATFPLRPMWLYGSIWDASSWATDNGRYKADYRYQ 226 >gb|KDO39060.1| hypothetical protein CISIN_1g043947mg, partial [Citrus sinensis] Length = 187 Score = 96.7 bits (239), Expect = 8e-21 Identities = 40/50 (80%), Positives = 47/50 (94%) Frame = +2 Query: 644 FFVDDIPIRQYLRKSSATFPLRPMWLYGSIWDASDWATENGRYRADYRYQ 793 F VDD+PIR+Y RKS+ATFPLRPMW+YGSIWDAS WATE+G+Y+ADYRYQ Sbjct: 68 FLVDDVPIRRYPRKSAATFPLRPMWVYGSIWDASSWATEDGKYKADYRYQ 117 >gb|PPD91467.1| hypothetical protein GOBAR_DD11611 [Gossypium barbadense] Length = 270 Score = 98.6 bits (244), Expect = 9e-21 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = +2 Query: 641 RFFVDDIPIRQYLRKSSATFPLRPMWLYGSIWDASDWATENGRYRADYRYQ 793 +FFVDD+PIR+Y RKS ATFP RPMW+YGSIWDAS WATENGRY+ADY YQ Sbjct: 151 KFFVDDVPIRRYPRKSDATFPTRPMWVYGSIWDASSWATENGRYKADYNYQ 201 >pdb|2VH9|A Chain A, Crystal Structure Of Nxg1-deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide pdb|2VH9|B Chain B, Crystal Structure Of Nxg1-deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide Length = 290 Score = 99.0 bits (245), Expect = 9e-21 Identities = 40/50 (80%), Positives = 47/50 (94%) Frame = +2 Query: 644 FFVDDIPIRQYLRKSSATFPLRPMWLYGSIWDASDWATENGRYRADYRYQ 793 FFVDD+PIR+Y RKS ATFPLRP+W+YGS+WDAS WATENG+Y+ADYRYQ Sbjct: 174 FFVDDVPIRRYPRKSDATFPLRPLWVYGSVWDASSWATENGKYKADYRYQ 223 >ref|XP_022883637.1| probable xyloglucan endotransglucosylase/hydrolase protein 32 isoform X2 [Olea europaea var. sylvestris] Length = 292 Score = 99.0 bits (245), Expect = 9e-21 Identities = 41/50 (82%), Positives = 47/50 (94%) Frame = +2 Query: 644 FFVDDIPIRQYLRKSSATFPLRPMWLYGSIWDASDWATENGRYRADYRYQ 793 FFVDD+PIR+Y RKS ATFPLRPMW+YGSIWDAS WATENG+Y+ADY+YQ Sbjct: 174 FFVDDVPIRRYPRKSDATFPLRPMWVYGSIWDASSWATENGKYKADYQYQ 223 >ref|XP_010535628.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 31 [Tarenaya hassleriana] Length = 293 Score = 99.0 bits (245), Expect = 9e-21 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = +2 Query: 644 FFVDDIPIRQYLRKSSATFPLRPMWLYGSIWDASDWATENGRYRADYRYQ 793 FFVDD+PIR+Y RKS ATFP RPMW+YGSIWDASDWATENGR +ADYRYQ Sbjct: 177 FFVDDVPIRRYERKSEATFPTRPMWVYGSIWDASDWATENGRIKADYRYQ 226 >ref|XP_009394629.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 32 [Musa acuminata subsp. malaccensis] Length = 293 Score = 99.0 bits (245), Expect = 9e-21 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = +2 Query: 644 FFVDDIPIRQYLRKSSATFPLRPMWLYGSIWDASDWATENGRYRADYRYQ 793 FFVDD+PIRQY RKS+ TFP RPMWLYGSIWDAS WATE+G+YRADYRYQ Sbjct: 174 FFVDDVPIRQYPRKSAGTFPQRPMWLYGSIWDASSWATEDGKYRADYRYQ 223 >emb|CAA48324.1| cellulase [Tropaeolum majus] Length = 295 Score = 99.0 bits (245), Expect = 1e-20 Identities = 40/50 (80%), Positives = 47/50 (94%) Frame = +2 Query: 644 FFVDDIPIRQYLRKSSATFPLRPMWLYGSIWDASDWATENGRYRADYRYQ 793 FFVDD+PIR+Y RKS ATFPLRP+W+YGS+WDAS WATENG+Y+ADYRYQ Sbjct: 179 FFVDDVPIRRYPRKSDATFPLRPLWVYGSVWDASSWATENGKYKADYRYQ 228 >emb|CBI30149.3| unnamed protein product, partial [Vitis vinifera] Length = 259 Score = 98.2 bits (243), Expect = 1e-20 Identities = 40/50 (80%), Positives = 47/50 (94%) Frame = +2 Query: 644 FFVDDIPIRQYLRKSSATFPLRPMWLYGSIWDASDWATENGRYRADYRYQ 793 FFVDD+P+R+Y RKS+ TFPLRPMWLYGSIWDAS WATE+G+Y+ADYRYQ Sbjct: 139 FFVDDVPVRRYPRKSATTFPLRPMWLYGSIWDASSWATEDGKYKADYRYQ 188 >ref|XP_022144717.1| probable xyloglucan endotransglucosylase/hydrolase protein 32, partial [Momordica charantia] Length = 325 Score = 99.4 bits (246), Expect = 1e-20 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 644 FFVDDIPIRQYLRKSSATFPLRPMWLYGSIWDASDWATENGRYRADYRYQ 793 F VDDIPIR+Y RKS+ATFPLRPMWLYGSIWDAS WATE+G+YRADYRYQ Sbjct: 205 FLVDDIPIRRYPRKSAATFPLRPMWLYGSIWDASSWATEDGKYRADYRYQ 254