BLASTX nr result
ID: Ophiopogon23_contig00041650
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00041650 (395 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PRQ46588.1| hypothetical protein RchiOBHm_Chr2g0090641 [Rosa ... 57 4e-08 gb|ERN07866.1| hypothetical protein AMTR_s00012p00214100 [Ambore... 57 5e-08 ref|XP_024006303.1| putative protein TPRXL [Eutrema salsugineum] 57 9e-08 gb|PLY91538.1| hypothetical protein LSAT_5X101501 [Lactuca sativa] 55 1e-07 gb|KJB06145.1| hypothetical protein B456_001G004700 [Gossypium r... 54 3e-07 gb|OUZ99927.1| hypothetical protein BVC80_9069g35 [Macleaya cord... 53 6e-07 gb|PIA65068.1| hypothetical protein AQUCO_00100507v1 [Aquilegia ... 54 6e-07 gb|OAY53734.1| hypothetical protein MANES_03G019500 [Manihot esc... 54 8e-07 dbj|GAU48792.1| hypothetical protein TSUD_141100 [Trifolium subt... 54 8e-07 gb|OTG13194.1| hypothetical protein HannXRQ_Chr10g0317871 [Helia... 54 8e-07 ref|XP_013453064.1| hypothetical protein MTR_6g086445 [Medicago ... 54 8e-07 ref|XP_009107136.1| PREDICTED: uncharacterized protein LOC103832... 53 1e-06 ref|XP_013626551.1| PREDICTED: uncharacterized protein LOC106332... 53 1e-06 ref|XP_013724791.1| uncharacterized protein BNAC03G69280D [Brass... 53 1e-06 ref|XP_022846371.1| uncharacterized protein LOC111369102 [Olea e... 54 1e-06 ref|XP_013721379.1| uncharacterized protein LOC106425203 [Brassi... 53 2e-06 ref|XP_013590689.1| PREDICTED: uncharacterized protein LOC106299... 53 2e-06 ref|XP_018466604.1| PREDICTED: uncharacterized protein LOC108838... 53 2e-06 ref|XP_013742774.1| uncharacterized protein LOC106445712 [Brassi... 53 2e-06 gb|EOY30820.1| Uncharacterized protein TCM_037899 [Theobroma cacao] 53 2e-06 >gb|PRQ46588.1| hypothetical protein RchiOBHm_Chr2g0090641 [Rosa chinensis] Length = 100 Score = 57.4 bits (137), Expect = 4e-08 Identities = 24/34 (70%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Frame = +1 Query: 253 RRCVCSPTRHPRSFRCRQHH-HLYQWGGKAAVEN 351 RRCVCSPTRHP SFRCRQHH Y WGG+ N Sbjct: 62 RRCVCSPTRHPGSFRCRQHHADQYVWGGRTVTRN 95 >gb|ERN07866.1| hypothetical protein AMTR_s00012p00214100 [Amborella trichopoda] Length = 98 Score = 57.0 bits (136), Expect = 5e-08 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = +1 Query: 259 CVCSPTRHPRSFRCRQHHHLYQWGGKAAVEN 351 C+CSPTRHP SFRCR HH YQWG K E+ Sbjct: 63 CICSPTRHPGSFRCRYHHKYYQWGSKRTTED 93 >ref|XP_024006303.1| putative protein TPRXL [Eutrema salsugineum] Length = 106 Score = 56.6 bits (135), Expect = 9e-08 Identities = 20/25 (80%), Positives = 23/25 (92%) Frame = +1 Query: 253 RRCVCSPTRHPRSFRCRQHHHLYQW 327 +RCVCSP++HPRSFRCR HHH YQW Sbjct: 45 KRCVCSPSKHPRSFRCRYHHHEYQW 69 >gb|PLY91538.1| hypothetical protein LSAT_5X101501 [Lactuca sativa] Length = 54 Score = 54.7 bits (130), Expect = 1e-07 Identities = 19/30 (63%), Positives = 26/30 (86%) Frame = +1 Query: 247 AVRRCVCSPTRHPRSFRCRQHHHLYQWGGK 336 ++++C+CSPT HP SFRCRQHH+ Y WGG+ Sbjct: 17 SLQQCLCSPTTHPGSFRCRQHHNKYVWGGR 46 >gb|KJB06145.1| hypothetical protein B456_001G004700 [Gossypium raimondii] Length = 73 Score = 54.3 bits (129), Expect = 3e-07 Identities = 19/32 (59%), Positives = 26/32 (81%) Frame = +1 Query: 241 VAAVRRCVCSPTRHPRSFRCRQHHHLYQWGGK 336 V ++++C+CSPT+HP SFRCR HH Y WGG+ Sbjct: 37 VGSMKQCLCSPTKHPGSFRCRHHHAEYVWGGR 68 >gb|OUZ99927.1| hypothetical protein BVC80_9069g35 [Macleaya cordata] Length = 57 Score = 53.1 bits (126), Expect = 6e-07 Identities = 19/31 (61%), Positives = 25/31 (80%) Frame = +1 Query: 244 AAVRRCVCSPTRHPRSFRCRQHHHLYQWGGK 336 A +R+C+CSPT+HP SFRCR H Y+WGG+ Sbjct: 20 AMMRQCLCSPTQHPGSFRCRHHQSEYEWGGR 50 >gb|PIA65068.1| hypothetical protein AQUCO_00100507v1 [Aquilegia coerulea] Length = 88 Score = 53.9 bits (128), Expect = 6e-07 Identities = 19/26 (73%), Positives = 23/26 (88%) Frame = +1 Query: 253 RRCVCSPTRHPRSFRCRQHHHLYQWG 330 ++C+CSPT+HP SFRCRQHH YQWG Sbjct: 60 KQCLCSPTKHPGSFRCRQHHSEYQWG 85 >gb|OAY53734.1| hypothetical protein MANES_03G019500 [Manihot esculenta] Length = 80 Score = 53.5 bits (127), Expect = 8e-07 Identities = 19/28 (67%), Positives = 24/28 (85%) Frame = +1 Query: 247 AVRRCVCSPTRHPRSFRCRQHHHLYQWG 330 ++++CVCSPTRHP SFRCR HH Y+WG Sbjct: 47 SMKKCVCSPTRHPGSFRCRHHHGDYEWG 74 >dbj|GAU48792.1| hypothetical protein TSUD_141100 [Trifolium subterraneum] Length = 83 Score = 53.5 bits (127), Expect = 8e-07 Identities = 20/30 (66%), Positives = 25/30 (83%) Frame = +1 Query: 247 AVRRCVCSPTRHPRSFRCRQHHHLYQWGGK 336 +V+RC+CSP++HP SFRCRQHH Y W GK Sbjct: 51 SVKRCMCSPSQHPGSFRCRQHHGEYVWRGK 80 >gb|OTG13194.1| hypothetical protein HannXRQ_Chr10g0317871 [Helianthus annuus] Length = 84 Score = 53.5 bits (127), Expect = 8e-07 Identities = 19/29 (65%), Positives = 23/29 (79%) Frame = +1 Query: 250 VRRCVCSPTRHPRSFRCRQHHHLYQWGGK 336 ++RC+CSPT HP SFRCR HH Y WGG+ Sbjct: 43 LKRCLCSPTHHPGSFRCRNHHDEYVWGGR 71 >ref|XP_013453064.1| hypothetical protein MTR_6g086445 [Medicago truncatula] gb|KEH27092.1| hypothetical protein MTR_6g086445 [Medicago truncatula] Length = 84 Score = 53.5 bits (127), Expect = 8e-07 Identities = 20/30 (66%), Positives = 25/30 (83%) Frame = +1 Query: 247 AVRRCVCSPTRHPRSFRCRQHHHLYQWGGK 336 +V+RCVCSP++HP SFRCRQHH Y W G+ Sbjct: 52 SVKRCVCSPSQHPGSFRCRQHHGEYVWRGR 81 >ref|XP_009107136.1| PREDICTED: uncharacterized protein LOC103832796 [Brassica rapa] Length = 78 Score = 53.1 bits (126), Expect = 1e-06 Identities = 18/25 (72%), Positives = 22/25 (88%) Frame = +1 Query: 253 RRCVCSPTRHPRSFRCRQHHHLYQW 327 ++CVCSP+ HPRSF+CR HHH YQW Sbjct: 46 KKCVCSPSTHPRSFKCRYHHHEYQW 70 >ref|XP_013626551.1| PREDICTED: uncharacterized protein LOC106332614 [Brassica oleracea var. oleracea] Length = 79 Score = 53.1 bits (126), Expect = 1e-06 Identities = 18/25 (72%), Positives = 22/25 (88%) Frame = +1 Query: 253 RRCVCSPTRHPRSFRCRQHHHLYQW 327 ++CVCSP+ HPRSF+CR HHH YQW Sbjct: 46 KKCVCSPSTHPRSFKCRYHHHEYQW 70 >ref|XP_013724791.1| uncharacterized protein BNAC03G69280D [Brassica napus] emb|CDY47534.1| BnaC03g69280D [Brassica napus] Length = 79 Score = 53.1 bits (126), Expect = 1e-06 Identities = 18/25 (72%), Positives = 22/25 (88%) Frame = +1 Query: 253 RRCVCSPTRHPRSFRCRQHHHLYQW 327 ++CVCSP+ HPRSF+CR HHH YQW Sbjct: 46 KKCVCSPSTHPRSFKCRYHHHEYQW 70 >ref|XP_022846371.1| uncharacterized protein LOC111369102 [Olea europaea var. sylvestris] Length = 95 Score = 53.5 bits (127), Expect = 1e-06 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +1 Query: 250 VRRCVCSPTRHPRSFRCRQHHHLYQWGGK 336 +RRCVCSPT HP SFRCR HH Y+W G+ Sbjct: 61 MRRCVCSPTNHPGSFRCRHHHAEYEWVGR 89 >ref|XP_013721379.1| uncharacterized protein LOC106425203 [Brassica napus] Length = 81 Score = 52.8 bits (125), Expect = 2e-06 Identities = 18/23 (78%), Positives = 21/23 (91%) Frame = +1 Query: 259 CVCSPTRHPRSFRCRQHHHLYQW 327 CVCSP++HPRSF+CR HHH YQW Sbjct: 43 CVCSPSKHPRSFKCRYHHHEYQW 65 >ref|XP_013590689.1| PREDICTED: uncharacterized protein LOC106299096 [Brassica oleracea var. oleracea] Length = 81 Score = 52.8 bits (125), Expect = 2e-06 Identities = 18/23 (78%), Positives = 21/23 (91%) Frame = +1 Query: 259 CVCSPTRHPRSFRCRQHHHLYQW 327 CVCSP++HPRSF+CR HHH YQW Sbjct: 43 CVCSPSKHPRSFKCRYHHHEYQW 65 >ref|XP_018466604.1| PREDICTED: uncharacterized protein LOC108838131 [Raphanus sativus] Length = 83 Score = 52.8 bits (125), Expect = 2e-06 Identities = 18/23 (78%), Positives = 21/23 (91%) Frame = +1 Query: 259 CVCSPTRHPRSFRCRQHHHLYQW 327 CVCSP++HPRSF+CR HHH YQW Sbjct: 43 CVCSPSKHPRSFKCRYHHHEYQW 65 >ref|XP_013742774.1| uncharacterized protein LOC106445712 [Brassica napus] ref|XP_013656664.1| uncharacterized protein LOC106361467 [Brassica napus] emb|CDY49900.1| BnaA05g14930D [Brassica napus] Length = 84 Score = 52.8 bits (125), Expect = 2e-06 Identities = 18/23 (78%), Positives = 21/23 (91%) Frame = +1 Query: 259 CVCSPTRHPRSFRCRQHHHLYQW 327 CVCSP++HPRSF+CR HHH YQW Sbjct: 43 CVCSPSKHPRSFKCRYHHHEYQW 65 >gb|EOY30820.1| Uncharacterized protein TCM_037899 [Theobroma cacao] Length = 84 Score = 52.8 bits (125), Expect = 2e-06 Identities = 18/30 (60%), Positives = 25/30 (83%) Frame = +1 Query: 247 AVRRCVCSPTRHPRSFRCRQHHHLYQWGGK 336 ++++C+CSPT+HP SFRCR HH Y WGG+ Sbjct: 50 SMKQCLCSPTKHPGSFRCRHHHAEYVWGGR 79