BLASTX nr result
ID: Ophiopogon23_contig00041577
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00041577 (447 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009420116.1| PREDICTED: basic blue protein-like [Musa acu... 54 3e-06 >ref|XP_009420116.1| PREDICTED: basic blue protein-like [Musa acuminata subsp. malaccensis] Length = 127 Score = 53.5 bits (127), Expect = 3e-06 Identities = 22/33 (66%), Positives = 30/33 (90%) Frame = +2 Query: 347 NFSPLNVAVFNYQSGVHNVVPVSAAGYRSCRAT 445 +F+P + VFNYQ+G+HNVVPV+AAGYRSC+A+ Sbjct: 53 SFAPGDTLVFNYQAGLHNVVPVNAAGYRSCKAS 85