BLASTX nr result
ID: Ophiopogon23_contig00041517
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00041517 (454 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU19205.1| hypothetical protein TSUD_198880 [Trifolium subt... 57 1e-07 >dbj|GAU19205.1| hypothetical protein TSUD_198880 [Trifolium subterraneum] Length = 120 Score = 57.4 bits (137), Expect = 1e-07 Identities = 29/36 (80%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = -2 Query: 435 GRTTVSGLNFNPSFFI-LKKGSKACFLLPLLIDQGP 331 GRTTVSGLNF+P FF+ + KGSKA FLLPLLIDQGP Sbjct: 40 GRTTVSGLNFDPYFFLHIVKGSKARFLLPLLIDQGP 75