BLASTX nr result
ID: Ophiopogon23_contig00040270
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00040270 (512 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK73950.1| uncharacterized protein A4U43_C03F1260 [Asparagus... 61 5e-09 >gb|ONK73950.1| uncharacterized protein A4U43_C03F1260 [Asparagus officinalis] Length = 119 Score = 61.2 bits (147), Expect = 5e-09 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -1 Query: 416 GTTAEEESQFSSDQEKGVLEVRARGPSRPGVKRPPGGQSN 297 G EEESQ DQEKG+LEVR+RGP+ PGVK PPGG++N Sbjct: 80 GAADEEESQLGLDQEKGILEVRSRGPAPPGVKSPPGGKTN 119