BLASTX nr result
ID: Ophiopogon23_contig00040167
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00040167 (467 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020265682.1| transmembrane 9 superfamily member 11-like [... 57 2e-06 >ref|XP_020265682.1| transmembrane 9 superfamily member 11-like [Asparagus officinalis] gb|ONK70402.1| uncharacterized protein A4U43_C05F33340 [Asparagus officinalis] Length = 664 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +1 Query: 343 VLCSVKHGLKSESVKDMKMHDKYSMKSQCEPLTIAMQLKEN 465 V CS +H L ESVK++KM+DKYS K QCEP T+AMQLKEN Sbjct: 224 VPCSFQHDL--ESVKNLKMYDKYSTKIQCEPSTVAMQLKEN 262