BLASTX nr result
ID: Ophiopogon23_contig00039791
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00039791 (462 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010943369.1| PREDICTED: uncharacterized protein LOC105061... 66 6e-10 gb|PKU78575.1| hypothetical protein MA16_Dca011132 [Dendrobium c... 57 2e-07 dbj|GAV70437.1| DUF4283 domain-containing protein/zf-CCHC_4 doma... 59 3e-07 ref|XP_010928992.1| PREDICTED: uncharacterized protein LOC105050... 57 5e-07 ref|XP_020678498.1| uncharacterized protein LOC110096765 [Dendro... 58 6e-07 ref|XP_016648872.1| PREDICTED: uncharacterized protein LOC107880... 57 6e-07 dbj|GAV72801.1| Exo_endo_phos domain-containing protein/DUF4283 ... 58 7e-07 dbj|GAV81238.1| DUF4283 domain-containing protein/zf-CCHC_4 doma... 57 9e-07 emb|CCA66008.1| hypothetical protein [Beta vulgaris subsp. vulga... 57 2e-06 ref|XP_022003171.1| uncharacterized protein LOC110900594 [Helian... 57 2e-06 dbj|GAV79554.1| DUF4283 domain-containing protein/zf-CCHC_4 doma... 55 2e-06 dbj|GAV82142.1| DUF4283 domain-containing protein/zf-CCHC_4 doma... 56 3e-06 dbj|GAV77195.1| Exo_endo_phos domain-containing protein/DUF4283 ... 56 3e-06 gb|PKU67677.1| hypothetical protein MA16_Dca023229 [Dendrobium c... 54 3e-06 dbj|GAV74915.1| DUF4283 domain-containing protein [Cephalotus fo... 56 4e-06 dbj|GAV92775.1| DUF4283 domain-containing protein/zf-CCHC_4 doma... 56 4e-06 dbj|GAV67466.1| DUF4283 domain-containing protein [Cephalotus fo... 55 5e-06 dbj|GAV92738.1| DUF4283 domain-containing protein/zf-CCHC_4 doma... 55 7e-06 gb|KYP66696.1| STS14 protein, partial [Cajanus cajan] 55 1e-05 >ref|XP_010943369.1| PREDICTED: uncharacterized protein LOC105061108 [Elaeis guineensis] Length = 304 Score = 66.2 bits (160), Expect = 6e-10 Identities = 33/93 (35%), Positives = 54/93 (58%) Frame = +3 Query: 177 TETDIQRLRKAFPSKITLPAALIDEGSHPFLHSLVGKFLGRPLSADRVLAALQPRWELAQ 356 TE +I RL++ F I + S + +SL+GK LG+ + D + L+ RW Sbjct: 52 TEDEIARLQQLFTDSIVFTDKEVAGASKKWSNSLIGKLLGKGVQLDFLSKELKLRWGGLG 111 Query: 357 EWELLPKSHGFFIFRFNCKDDVDWVLQHGPWIV 455 +++++P S G +F+FN +D DWVL +GPWI+ Sbjct: 112 DFKVVPLSIGHQVFQFNSEDCRDWVLANGPWII 144 >gb|PKU78575.1| hypothetical protein MA16_Dca011132 [Dendrobium catenatum] Length = 139 Score = 57.4 bits (137), Expect = 2e-07 Identities = 28/79 (35%), Positives = 44/79 (55%) Frame = +3 Query: 219 KITLPAALIDEGSHPFLHSLVGKFLGRPLSADRVLAALQPRWELAQEWELLPKSHGFFIF 398 K++ AA EG+ + HSLVG LG+ +R+LAA+ W L + LL + G F+ Sbjct: 52 KLSFKAADFSEGATIWTHSLVGYSLGQRPYYERLLAAMNKTWTLKGSFSLLSMADGLFLL 111 Query: 399 RFNCKDDVDWVLQHGPWIV 455 +F +D++ V GPW + Sbjct: 112 KFTSAEDMEMVFSGGPWFL 130 >dbj|GAV70437.1| DUF4283 domain-containing protein/zf-CCHC_4 domain-containing protein [Cephalotus follicularis] Length = 250 Score = 58.5 bits (140), Expect = 3e-07 Identities = 24/76 (31%), Positives = 44/76 (57%) Frame = +3 Query: 228 LPAALIDEGSHPFLHSLVGKFLGRPLSADRVLAALQPRWELAQEWELLPKSHGFFIFRFN 407 +P ++ EG+ + H+LVG F+G+ + +L L +W L ++ + +G FIF++ Sbjct: 4 MPEEILAEGAKEWEHALVGFFVGKKIPFRSLLTVLNKKWSLVGKFSIHTAENGIFIFKYE 63 Query: 408 CKDDVDWVLQHGPWIV 455 + DW+L +GPW V Sbjct: 64 SEAARDWILNNGPWDV 79 >ref|XP_010928992.1| PREDICTED: uncharacterized protein LOC105050610 [Elaeis guineensis] Length = 218 Score = 57.4 bits (137), Expect = 5e-07 Identities = 31/91 (34%), Positives = 46/91 (50%) Frame = +3 Query: 177 TETDIQRLRKAFPSKITLPAALIDEGSHPFLHSLVGKFLGRPLSADRVLAALQPRWELAQ 356 T +I L K F + + +H + +LVGKFL R D V ++ RW L Sbjct: 5 TAKEIAVLEKQFTQLVVFSDDELQRTAHRYKSALVGKFLSRGFPLDFVAEEMRMRWNLEG 64 Query: 357 EWELLPKSHGFFIFRFNCKDDVDWVLQHGPW 449 E+++LP S GF +F F ++ VL+ GPW Sbjct: 65 EFQVLPLSKGFILFCFALEEIRARVLEKGPW 95 >ref|XP_020678498.1| uncharacterized protein LOC110096765 [Dendrobium catenatum] Length = 488 Score = 58.2 bits (139), Expect = 6e-07 Identities = 27/79 (34%), Positives = 46/79 (58%) Frame = +3 Query: 219 KITLPAALIDEGSHPFLHSLVGKFLGRPLSADRVLAALQPRWELAQEWELLPKSHGFFIF 398 K++ A EG++ + HSLVG +G+ + +R+LAA+ W L + LL + GFF+ Sbjct: 100 KLSFKAVDFTEGANIWTHSLVGYSIGQRPNYERLLAAMNKLWVLKGSFSLLSMADGFFLL 159 Query: 399 RFNCKDDVDWVLQHGPWIV 455 +F +D++ V GPW + Sbjct: 160 KFTSAEDMELVFSGGPWFL 178 >ref|XP_016648872.1| PREDICTED: uncharacterized protein LOC107880872 [Prunus mume] Length = 206 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/65 (36%), Positives = 43/65 (66%) Frame = +3 Query: 261 PFLHSLVGKFLGRPLSADRVLAALQPRWELAQEWELLPKSHGFFIFRFNCKDDVDWVLQH 440 P+ H+L+ K LGRP + + + A LQ +W L W+L+ + +F+ +F+ ++D++ VL Sbjct: 114 PWQHALIIKLLGRPHTYNFLHARLQQKWNLKGGWKLIDLVNDYFVVKFDLEEDLNSVLTG 173 Query: 441 GPWIV 455 GPWI+ Sbjct: 174 GPWII 178 >dbj|GAV72801.1| Exo_endo_phos domain-containing protein/DUF4283 domain-containing protein, partial [Cephalotus follicularis] Length = 653 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/76 (32%), Positives = 44/76 (57%) Frame = +3 Query: 228 LPAALIDEGSHPFLHSLVGKFLGRPLSADRVLAALQPRWELAQEWELLPKSHGFFIFRFN 407 +P ++ EG+ + H+LVG F+G+ + +LA L +W ++ + +G FIF+F Sbjct: 19 MPEEILVEGAKEWEHALVGFFVGKKIPFRSLLAVLNKKWSSVGKFTIHTADNGIFIFKFE 78 Query: 408 CKDDVDWVLQHGPWIV 455 + DW+L +GPW V Sbjct: 79 SEAARDWILNNGPWDV 94 >dbj|GAV81238.1| DUF4283 domain-containing protein/zf-CCHC_4 domain-containing protein [Cephalotus follicularis] Length = 289 Score = 57.4 bits (137), Expect = 9e-07 Identities = 24/76 (31%), Positives = 44/76 (57%) Frame = +3 Query: 228 LPAALIDEGSHPFLHSLVGKFLGRPLSADRVLAALQPRWELAQEWELLPKSHGFFIFRFN 407 +P ++ EG+ + H+LVG F+G+ + +LA L +W ++ + +G FIF++ Sbjct: 83 MPEEILVEGAKEWEHALVGFFVGKKIPFRSLLAVLNKKWSSVGKFSIHTADNGIFIFKYE 142 Query: 408 CKDDVDWVLQHGPWIV 455 + DW+L +GPW V Sbjct: 143 SEAARDWILNNGPWDV 158 >emb|CCA66008.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 678 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/68 (36%), Positives = 40/68 (58%) Frame = +3 Query: 258 HPFLHSLVGKFLGRPLSADRVLAALQPRWELAQEWELLPKSHGFFIFRFNCKDDVDWVLQ 437 HP+ +SL+ K R LS D ++ L+ +W L + L H +++ RFN +D D+VL Sbjct: 134 HPWRNSLIIKLFDRRLSYDILVRRLKYKWNLKGDIALTDVGHAYYVVRFNNMEDYDFVLT 193 Query: 438 HGPWIVDD 461 GPW++ D Sbjct: 194 QGPWLIGD 201 >ref|XP_022003171.1| uncharacterized protein LOC110900594 [Helianthus annuus] Length = 347 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/78 (35%), Positives = 44/78 (56%) Frame = +3 Query: 222 ITLPAALIDEGSHPFLHSLVGKFLGRPLSADRVLAALQPRWELAQEWELLPKSHGFFIFR 401 +T+P A + + F + L G FLG+ L+ V ++ RWE + + GFF F+ Sbjct: 12 VTIPVASVRQVQDRFANVLFGYFLGKRLAFPVVDYYVKNRWEKYGLQKSMMNGKGFFFFK 71 Query: 402 FNCKDDVDWVLQHGPWIV 455 FN K+ +D VLQ GPW++ Sbjct: 72 FNSKEGMDQVLQDGPWLI 89 >dbj|GAV79554.1| DUF4283 domain-containing protein/zf-CCHC_4 domain-containing protein [Cephalotus follicularis] Length = 207 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/76 (30%), Positives = 43/76 (56%) Frame = +3 Query: 228 LPAALIDEGSHPFLHSLVGKFLGRPLSADRVLAALQPRWELAQEWELLPKSHGFFIFRFN 407 +P ++ EG+ + H+LVG F+G+ + + A L +W ++ + +G FIF++ Sbjct: 1 MPEEILVEGAKEWEHALVGFFVGKKIPFRSLFAVLNKKWSSVGKFTIHTAENGIFIFKYE 60 Query: 408 CKDDVDWVLQHGPWIV 455 + DW+L +GPW V Sbjct: 61 SEAARDWILNNGPWDV 76 >dbj|GAV82142.1| DUF4283 domain-containing protein/zf-CCHC_4 domain-containing protein [Cephalotus follicularis] Length = 414 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/76 (30%), Positives = 43/76 (56%) Frame = +3 Query: 228 LPAALIDEGSHPFLHSLVGKFLGRPLSADRVLAALQPRWELAQEWELLPKSHGFFIFRFN 407 +P ++ EG+ + H+LVG F+G+ + +L L +W ++ + +G FIF++ Sbjct: 79 MPEEILAEGAKEWEHALVGFFVGKKIPFRSLLTVLNKKWSSVGKFSIHTDENGIFIFKYE 138 Query: 408 CKDDVDWVLQHGPWIV 455 + DW+L +GPW V Sbjct: 139 SEAARDWILNNGPWDV 154 >dbj|GAV77195.1| Exo_endo_phos domain-containing protein/DUF4283 domain-containing protein, partial [Cephalotus follicularis] Length = 653 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/76 (30%), Positives = 44/76 (57%) Frame = +3 Query: 228 LPAALIDEGSHPFLHSLVGKFLGRPLSADRVLAALQPRWELAQEWELLPKSHGFFIFRFN 407 +P ++ EG+ + H+LVG F+G+ + +L +L +W ++ + +G FIF+F Sbjct: 19 MPEDILVEGAKEWEHALVGFFVGKKIPFRSLLTSLNKKWSSVGKFSIHTADNGIFIFKFE 78 Query: 408 CKDDVDWVLQHGPWIV 455 + DW++ +GPW V Sbjct: 79 TEAARDWIINNGPWDV 94 >gb|PKU67677.1| hypothetical protein MA16_Dca023229 [Dendrobium catenatum] Length = 137 Score = 53.9 bits (128), Expect = 3e-06 Identities = 25/79 (31%), Positives = 43/79 (54%) Frame = +3 Query: 219 KITLPAALIDEGSHPFLHSLVGKFLGRPLSADRVLAALQPRWELAQEWELLPKSHGFFIF 398 K + A EG++ + HSL+G + + +R+LAA+ W L + LL + GFF+ Sbjct: 52 KFSFKAKDFSEGANIWTHSLIGYSINQRPYYERLLAAMNKAWVLKGSFSLLSLADGFFLL 111 Query: 399 RFNCKDDVDWVLQHGPWIV 455 +F +D++ V GPW + Sbjct: 112 KFTSAEDMEMVFLGGPWFI 130 >dbj|GAV74915.1| DUF4283 domain-containing protein [Cephalotus follicularis] Length = 339 Score = 55.8 bits (133), Expect = 4e-06 Identities = 23/76 (30%), Positives = 43/76 (56%) Frame = +3 Query: 228 LPAALIDEGSHPFLHSLVGKFLGRPLSADRVLAALQPRWELAQEWELLPKSHGFFIFRFN 407 +P ++ EG+ + H+LVG F+G+ + +L L +W ++ + +G FIF++ Sbjct: 4 MPEEILAEGAKEWEHALVGFFVGKKIPFRSLLTVLNKKWSSVGKFSIHTVENGIFIFKYE 63 Query: 408 CKDDVDWVLQHGPWIV 455 + DW+L +GPW V Sbjct: 64 SEAARDWILNNGPWDV 79 >dbj|GAV92775.1| DUF4283 domain-containing protein/zf-CCHC_4 domain-containing protein, partial [Cephalotus follicularis] Length = 355 Score = 55.8 bits (133), Expect = 4e-06 Identities = 23/80 (28%), Positives = 47/80 (58%) Frame = +3 Query: 216 SKITLPAALIDEGSHPFLHSLVGKFLGRPLSADRVLAALQPRWELAQEWELLPKSHGFFI 395 S LP +++EG+ + H+LVG F+G+ + + + L+ +W +A ++ + +G F+ Sbjct: 16 SMAELPEEVLEEGAKEWEHALVGFFVGKKIPFRSLQSVLRKKWSVAGKFSIHTADNGIFV 75 Query: 396 FRFNCKDDVDWVLQHGPWIV 455 F+ + +W+L +GPW V Sbjct: 76 FKCETAEVRNWILDNGPWDV 95 >dbj|GAV67466.1| DUF4283 domain-containing protein [Cephalotus follicularis] Length = 400 Score = 55.5 bits (132), Expect = 5e-06 Identities = 23/76 (30%), Positives = 43/76 (56%) Frame = +3 Query: 228 LPAALIDEGSHPFLHSLVGKFLGRPLSADRVLAALQPRWELAQEWELLPKSHGFFIFRFN 407 +P ++ EG+ + H+LVG F+G+ + + A L +W ++ + +G FIF++ Sbjct: 65 MPEEILVEGAKEWEHTLVGFFVGKKIPFRSLFAVLNKKWSSVGKFTIHTAENGIFIFKYE 124 Query: 408 CKDDVDWVLQHGPWIV 455 + DW+L +GPW V Sbjct: 125 SEAARDWILNNGPWDV 140 >dbj|GAV92738.1| DUF4283 domain-containing protein/zf-CCHC_4 domain-containing protein [Cephalotus follicularis] Length = 419 Score = 55.1 bits (131), Expect = 7e-06 Identities = 23/80 (28%), Positives = 46/80 (57%) Frame = +3 Query: 216 SKITLPAALIDEGSHPFLHSLVGKFLGRPLSADRVLAALQPRWELAQEWELLPKSHGFFI 395 S LP +++EG+ + H+LVG F+G+ + + + L +W +A ++ + +G F+ Sbjct: 80 SMAELPEEVLEEGAKEWEHALVGFFVGKKIPFRSLQSVLNKKWSVAGKFSIHTADNGIFV 139 Query: 396 FRFNCKDDVDWVLQHGPWIV 455 F+ + +W+L +GPW V Sbjct: 140 FKCETVEVRNWILDNGPWDV 159 >gb|KYP66696.1| STS14 protein, partial [Cajanus cajan] Length = 458 Score = 54.7 bits (130), Expect = 1e-05 Identities = 27/81 (33%), Positives = 47/81 (58%) Frame = +3 Query: 219 KITLPAALIDEGSHPFLHSLVGKFLGRPLSADRVLAALQPRWELAQEWELLPKSHGFFIF 398 K T+ + D+ +P+ LV K LG+ L + ++ W+LA +ELL S+G+F+ Sbjct: 21 KFTIAPSTFDQLCNPWRACLVVKLLGKRLGFFTLREKMKATWKLAGGFELLDVSNGYFLV 80 Query: 399 RFNCKDDVDWVLQHGPWIVDD 461 +F+ + D D V+ GPW++ D Sbjct: 81 KFDMEIDRDKVINEGPWMIFD 101