BLASTX nr result
ID: Ophiopogon23_contig00039420
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00039420 (839 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012575066.1| PREDICTED: uncharacterized protein LOC101494... 67 9e-11 gb|OWM62564.1| hypothetical protein CDL15_Pgr000052 [Punica gran... 66 5e-10 >ref|XP_012575066.1| PREDICTED: uncharacterized protein LOC101494761 [Cicer arietinum] Length = 420 Score = 67.4 bits (163), Expect(2) = 9e-11 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = +1 Query: 709 PPPQAEFVSRVIGDHFARFGGHVE*AAGARLRLYPYPIFGPIP 837 P PQAE VS VIGDHFARFG +E AAG+RLRL PYPIFGPIP Sbjct: 54 PTPQAELVSGVIGDHFARFGA-LESAAGSRLRLDPYPIFGPIP 95 Score = 28.1 bits (61), Expect(2) = 9e-11 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 681 APYRRRIIGTPTP 719 AP RRRIIGTPTP Sbjct: 44 APDRRRIIGTPTP 56 >gb|OWM62564.1| hypothetical protein CDL15_Pgr000052 [Punica granatum] Length = 126 Score = 66.2 bits (160), Expect = 5e-10 Identities = 35/65 (53%), Positives = 38/65 (58%), Gaps = 1/65 (1%) Frame = -1 Query: 773 CPPNRAKWSPITRLTNSAWGGGTYYSSAVXXXXXXXXXXXLP-MHFLQSAMEPSSAPPSQ 597 CPPNRAKWSPITRLTNSAWGG TYYSSAV +F Q P S S Sbjct: 43 CPPNRAKWSPITRLTNSAWGGDTYYSSAVRRTPTHNKDAATSRRNFFQHLESPLSLSASS 102 Query: 596 KERTA 582 +E T+ Sbjct: 103 QEWTS 107