BLASTX nr result
ID: Ophiopogon23_contig00038938
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00038938 (642 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK63985.1| uncharacterized protein A4U43_C07F20930 [Asparagu... 57 1e-06 >gb|ONK63985.1| uncharacterized protein A4U43_C07F20930 [Asparagus officinalis] Length = 173 Score = 57.0 bits (136), Expect = 1e-06 Identities = 25/59 (42%), Positives = 34/59 (57%) Frame = -2 Query: 308 RVVDRKLKVAISERPPPNEIPKCICGARLKMNIS*TENNPGCRFGACSFSTCKDWLWLE 132 R D++L + RPPP EIP CG ++M S T +P RFG C+ +TC W WL+ Sbjct: 46 RFFDKRLYATMWNRPPPYEIPNFFCGIPVQMKTSYTLRHPCRRFGICATNTCNCWTWLD 104