BLASTX nr result
ID: Ophiopogon23_contig00038920
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00038920 (587 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK60758.1| uncharacterized protein A4U43_C08F22280 [Asparagu... 80 1e-15 >gb|ONK60758.1| uncharacterized protein A4U43_C08F22280 [Asparagus officinalis] Length = 131 Score = 79.7 bits (195), Expect = 1e-15 Identities = 34/60 (56%), Positives = 40/60 (66%) Frame = -1 Query: 242 PSPQAAMEVCFQHCEDAVSDCVVDGCIHIPSGKDQAVCIDGCVQALPICKYNCQLAAGDD 63 P P + E+C Q CE++VS+CVVD C+HIPSG DQA CI C Q L CKY CQ A D Sbjct: 66 PCPHKSFEMCEQECENSVSECVVDSCLHIPSGDDQAFCISECTQELSSCKYGCQQADEGD 125