BLASTX nr result
ID: Ophiopogon23_contig00038902
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00038902 (372 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020244904.1| uncharacterized protein LOC109823003 [Aspara... 46 1e-06 >ref|XP_020244904.1| uncharacterized protein LOC109823003 [Asparagus officinalis] Length = 291 Score = 46.2 bits (108), Expect(3) = 1e-06 Identities = 21/49 (42%), Positives = 37/49 (75%) Frame = -1 Query: 282 NEQFRLQHDQFYLHRNHKNRKILSIDLNKIINIKKTYYFFR*KQKIITK 136 N+ Q QF+L R+ ++R+ILSIDL+KI+++++ +F R KQ+II++ Sbjct: 204 NQLLAQQRAQFHLERDREDREILSIDLSKIVDVREHAFFERKKQQIISR 252 Score = 29.6 bits (65), Expect(3) = 1e-06 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -2 Query: 341 KQKID*RTAQLEQRNQLFSQ 282 K+K+D R QLEQRNQL +Q Sbjct: 190 KKKLDQRAVQLEQRNQLLAQ 209 Score = 23.5 bits (49), Expect(3) = 1e-06 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = -3 Query: 127 NFQFDNST*PSK*ATYEDS*SY*LGPRGYENHLLEF 20 +FQFD+ST S Y Y G Y N L EF Sbjct: 256 DFQFDSSTHVSGGTGYWGPSGYQYGTGSYGNDLPEF 291