BLASTX nr result
ID: Ophiopogon23_contig00038788
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00038788 (572 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KUM45861.1| hypothetical protein ABT39_MTgene2215 (mitochondr... 70 8e-13 gb|KUM45860.1| hypothetical protein ABT39_MTgene2214 (mitochondr... 66 5e-11 >gb|KUM45861.1| hypothetical protein ABT39_MTgene2215 (mitochondrion) [Picea glauca] Length = 46 Score = 69.7 bits (169), Expect = 8e-13 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -2 Query: 112 MHGRIGVADQEPADQSQTAVTLSHPGTTRRGPGISAP 2 MH +I VADQEPADQSQTAV LSHPGTTRRGPGISAP Sbjct: 1 MHRKIEVADQEPADQSQTAVRLSHPGTTRRGPGISAP 37 >gb|KUM45860.1| hypothetical protein ABT39_MTgene2214 (mitochondrion) [Picea glauca] Length = 79 Score = 65.9 bits (159), Expect = 5e-11 Identities = 33/52 (63%), Positives = 37/52 (71%) Frame = +1 Query: 202 MHLTDREDYVEWYASVSTGPILPPHMRIGSVLNLNFRIVRSSLSCYITRRER 357 MHLTDREDYVEW ASVSTGPILPPHMRIGS N+ I + +I + R Sbjct: 1 MHLTDREDYVEWSASVSTGPILPPHMRIGS----NYAIRGGQAASWIAKLRR 48