BLASTX nr result
ID: Ophiopogon23_contig00038700
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00038700 (465 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OXU25066.1| hypothetical protein TSAR_000904 [Trichomalopsis ... 56 3e-06 >gb|OXU25066.1| hypothetical protein TSAR_000904 [Trichomalopsis sarcophagae] Length = 1373 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/68 (41%), Positives = 42/68 (61%), Gaps = 4/68 (5%) Frame = +3 Query: 273 ANEFDYETEAELSNAQN----EEQLEDELIKQVSTTSDLISERTKFRLQKLIEKHIEGIW 440 + + ++ET + A ++L+ +K S + DLI+E+ +FRLQKLIEKH EGIW Sbjct: 339 SEDLNHETVEAMDTASQFSGYRQELKSTPMKAHSVSDDLINEKIRFRLQKLIEKHPEGIW 398 Query: 441 SSDLPEAY 464 S+LP Y Sbjct: 399 CSELPNEY 406