BLASTX nr result
ID: Ophiopogon23_contig00038314
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00038314 (444 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020269331.1| uncharacterized protein LOC109844630 isoform... 56 3e-06 ref|XP_020269330.1| uncharacterized protein LOC109844630 isoform... 56 3e-06 >ref|XP_020269331.1| uncharacterized protein LOC109844630 isoform X2 [Asparagus officinalis] Length = 333 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/42 (66%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = +2 Query: 320 MVVLK-KEGFRLISNLCNPFCNNWGLMSLNKVLHSARFLGYS 442 MV+L+ KEG LISN CN N+WG M+LNKVLHS RFL YS Sbjct: 1 MVILRRKEGLWLISNHCNSLWNSWGSMALNKVLHSTRFLEYS 42 >ref|XP_020269330.1| uncharacterized protein LOC109844630 isoform X1 [Asparagus officinalis] gb|ONK66001.1| uncharacterized protein A4U43_C06F3160 [Asparagus officinalis] Length = 340 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/42 (66%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = +2 Query: 320 MVVLK-KEGFRLISNLCNPFCNNWGLMSLNKVLHSARFLGYS 442 MV+L+ KEG LISN CN N+WG M+LNKVLHS RFL YS Sbjct: 1 MVILRRKEGLWLISNHCNSLWNSWGSMALNKVLHSTRFLEYS 42