BLASTX nr result
ID: Ophiopogon23_contig00038242
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00038242 (416 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020266999.1| uncharacterized protein LOC109842544 [Aspara... 70 1e-11 >ref|XP_020266999.1| uncharacterized protein LOC109842544 [Asparagus officinalis] gb|ONK70277.1| uncharacterized protein A4U43_C05F32080 [Asparagus officinalis] Length = 228 Score = 69.7 bits (169), Expect = 1e-11 Identities = 37/78 (47%), Positives = 49/78 (62%) Frame = -1 Query: 380 ELVKDNHNSMEDDISPGSTSSQEEQYRLFDGGDQEDSENRIVAQRGSRISHVFRCWLPYS 201 E+ DNHN+ +D+SP +SSQ EQ L D +ED EN A R R++ FR WL YS Sbjct: 158 EIRGDNHNNKVEDVSP--SSSQGEQCGLIDACKKEDKENMAAANREFRLADFFRTWLSYS 215 Query: 200 KLGSPHKSDRNPKPGKYF 147 K +S+++PKPGKYF Sbjct: 216 K-----RSEKSPKPGKYF 228