BLASTX nr result
ID: Ophiopogon23_contig00038229
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00038229 (404 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OMO57353.1| hypothetical protein COLO4_35424 [Corchorus olito... 57 8e-07 dbj|GAU33049.1| hypothetical protein TSUD_152040 [Trifolium subt... 55 2e-06 dbj|GAU51714.1| hypothetical protein TSUD_265630 [Trifolium subt... 54 7e-06 >gb|OMO57353.1| hypothetical protein COLO4_35424 [Corchorus olitorius] Length = 309 Score = 57.0 bits (136), Expect = 8e-07 Identities = 33/75 (44%), Positives = 44/75 (58%), Gaps = 1/75 (1%) Frame = -1 Query: 224 DMILGMKELLPSLFSLSYNTDGIVSDMGYWINNEWKWVLQFRRNLSGGLVQQLDMLLEIL 45 DMIL K L P +FSL+ N +G +S+ G WI+++W W + R NL G Q D LL +L Sbjct: 53 DMIL--KVLFPRIFSLAVNKNGKISEYGEWIDDKWVWRIHLRLNLFGWEQNQWDELLVLL 110 Query: 44 ETCPLSFT-EDVRIW 3 E LS +D IW Sbjct: 111 ENVCLSLDFKDKLIW 125 >dbj|GAU33049.1| hypothetical protein TSUD_152040 [Trifolium subterraneum] Length = 189 Score = 54.7 bits (130), Expect = 2e-06 Identities = 27/69 (39%), Positives = 40/69 (57%) Frame = -1 Query: 209 MKELLPSLFSLSYNTDGIVSDMGYWINNEWKWVLQFRRNLSGGLVQQLDMLLEILETCPL 30 +K SLF LS +V +MGYW+N EW W+ ++RR+LS + L+ LL +++T PL Sbjct: 75 LKIQFQSLFQLSDQQLDLVGEMGYWLNLEWHWMFRWRRDLSVLEIGLLEALLSVVQTTPL 134 Query: 29 SFTEDVRIW 3 D W Sbjct: 135 LGVVDSWSW 143 >dbj|GAU51714.1| hypothetical protein TSUD_265630 [Trifolium subterraneum] Length = 232 Score = 53.9 bits (128), Expect = 7e-06 Identities = 25/64 (39%), Positives = 36/64 (56%) Frame = -1 Query: 194 PSLFSLSYNTDGIVSDMGYWINNEWKWVLQFRRNLSGGLVQQLDMLLEILETCPLSFTED 15 P LF +S D V +MG W+N +W+W L +RR L V LD LL +L + +S D Sbjct: 76 PRLFQVSQQRDSKVGEMGNWVNGDWRWDLSWRRELFVWEVGLLDDLLRVLNSYHISDALD 135 Query: 14 VRIW 3 + +W Sbjct: 136 ICVW 139