BLASTX nr result
ID: Ophiopogon23_contig00037891
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00037891 (415 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020269768.1| tryptophan aminotransferase-related protein ... 65 2e-09 ref|XP_020251483.1| LOW QUALITY PROTEIN: tryptophan aminotransfe... 58 4e-07 ref|XP_020270596.1| tryptophan aminotransferase-related protein ... 57 1e-06 ref|XP_009393612.1| PREDICTED: tryptophan aminotransferase-relat... 57 1e-06 ref|XP_023530753.1| tryptophan aminotransferase-related protein ... 56 2e-06 ref|XP_023530752.1| tryptophan aminotransferase-related protein ... 56 2e-06 ref|XP_022972098.1| tryptophan aminotransferase-related protein ... 56 2e-06 ref|XP_022925129.1| tryptophan aminotransferase-related protein ... 56 2e-06 ref|XP_008795991.1| PREDICTED: tryptophan aminotransferase-relat... 55 7e-06 ref|XP_011655256.1| PREDICTED: tryptophan aminotransferase-relat... 54 8e-06 ref|XP_004138271.1| PREDICTED: tryptophan aminotransferase-relat... 54 9e-06 ref|XP_008464530.1| PREDICTED: tryptophan aminotransferase-relat... 54 9e-06 ref|XP_011655140.1| PREDICTED: tryptophan aminotransferase-relat... 54 9e-06 >ref|XP_020269768.1| tryptophan aminotransferase-related protein 2-like [Asparagus officinalis] Length = 392 Score = 64.7 bits (156), Expect = 2e-09 Identities = 32/39 (82%), Positives = 33/39 (84%) Frame = -3 Query: 335 KILTRRAKHFRVEAKYVRASMWDREETFDLFIERFSSLK 219 KILTR KHF VEAKYVR SM DR+ETFDLFIER SSLK Sbjct: 354 KILTRSGKHFGVEAKYVRVSMLDRDETFDLFIERLSSLK 392 >ref|XP_020251483.1| LOW QUALITY PROTEIN: tryptophan aminotransferase-related protein 2-like [Asparagus officinalis] Length = 454 Score = 58.2 bits (139), Expect = 4e-07 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -3 Query: 335 KILTRRAKHFRVEAKYVRASMWDREETFDLFIERFSSLK 219 KI+TR +HF VEA YVR SM DR ETFDLFIER SSL+ Sbjct: 416 KIITRSGRHFGVEATYVRVSMLDRSETFDLFIERLSSLQ 454 >ref|XP_020270596.1| tryptophan aminotransferase-related protein 2-like [Asparagus officinalis] Length = 454 Score = 57.0 bits (136), Expect = 1e-06 Identities = 29/39 (74%), Positives = 30/39 (76%) Frame = -3 Query: 338 LKILTRRAKHFRVEAKYVRASMWDREETFDLFIERFSSL 222 LKILTR KHF V KYVR SM DREETF+LFIER SL Sbjct: 415 LKILTRGGKHFGVGMKYVRVSMLDREETFNLFIERLESL 453 >ref|XP_009393612.1| PREDICTED: tryptophan aminotransferase-related protein 2-like [Musa acuminata subsp. malaccensis] Length = 468 Score = 56.6 bits (135), Expect = 1e-06 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -3 Query: 335 KILTRRAKHFRVEAKYVRASMWDREETFDLFIERFSSLK 219 K+LTR +HF VEAKYVR S+ DR+ETFDLFI+R SL+ Sbjct: 430 KLLTRSGRHFGVEAKYVRISLLDRDETFDLFIQRLLSLR 468 >ref|XP_023530753.1| tryptophan aminotransferase-related protein 2-like isoform X2 [Cucurbita pepo subsp. pepo] Length = 354 Score = 55.8 bits (133), Expect = 2e-06 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = -3 Query: 335 KILTRRAKHFRVEAKYVRASMWDREETFDLFIERFSSLK 219 KILTR KHF V KYVR SM DREET+DLFI+R S ++ Sbjct: 315 KILTRGGKHFGVSPKYVRISMMDREETYDLFIQRLSQIR 353 >ref|XP_023530752.1| tryptophan aminotransferase-related protein 2-like isoform X1 [Cucurbita pepo subsp. pepo] Length = 440 Score = 55.8 bits (133), Expect = 2e-06 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = -3 Query: 335 KILTRRAKHFRVEAKYVRASMWDREETFDLFIERFSSLK 219 KILTR KHF V KYVR SM DREET+DLFI+R S ++ Sbjct: 401 KILTRGGKHFGVSPKYVRISMMDREETYDLFIQRLSQIR 439 >ref|XP_022972098.1| tryptophan aminotransferase-related protein 2-like [Cucurbita maxima] Length = 440 Score = 55.8 bits (133), Expect = 2e-06 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = -3 Query: 335 KILTRRAKHFRVEAKYVRASMWDREETFDLFIERFSSLK 219 KILTR KHF V KYVR SM DREET+DLFI+R S ++ Sbjct: 401 KILTRGGKHFGVSPKYVRISMMDREETYDLFIQRLSQIR 439 >ref|XP_022925129.1| tryptophan aminotransferase-related protein 2-like [Cucurbita moschata] Length = 440 Score = 55.8 bits (133), Expect = 2e-06 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = -3 Query: 335 KILTRRAKHFRVEAKYVRASMWDREETFDLFIERFSSLK 219 KILTR KHF V KYVR SM DREET+DLFI+R S ++ Sbjct: 401 KILTRGGKHFGVSPKYVRISMMDREETYDLFIQRLSQIR 439 >ref|XP_008795991.1| PREDICTED: tryptophan aminotransferase-related protein 2-like [Phoenix dactylifera] ref|XP_017699406.1| PREDICTED: tryptophan aminotransferase-related protein 2-like [Phoenix dactylifera] Length = 589 Score = 54.7 bits (130), Expect = 7e-06 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = -3 Query: 335 KILTRRAKHFRVEAKYVRASMWDREETFDLFIERFSSL 222 +ILTR +HF E KYVR SM DR+ETF LFIER SSL Sbjct: 551 RILTRSGRHFGAEPKYVRVSMLDRDETFQLFIERLSSL 588 >ref|XP_011655256.1| PREDICTED: tryptophan aminotransferase-related protein 2-like isoform X2 [Cucumis sativus] ref|XP_011655290.1| PREDICTED: tryptophan aminotransferase-related protein 2-like isoform X2 [Cucumis sativus] Length = 354 Score = 54.3 bits (129), Expect = 8e-06 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -3 Query: 335 KILTRRAKHFRVEAKYVRASMWDREETFDLFIERFSSLK 219 KILTR KHF V +KYVR SM DREET++LF+ER S ++ Sbjct: 315 KILTRGGKHFGVGSKYVRISMLDREETYNLFVERLSQIR 353 >ref|XP_004138271.1| PREDICTED: tryptophan aminotransferase-related protein 2-like isoform X1 [Cucumis sativus] Length = 438 Score = 54.3 bits (129), Expect = 9e-06 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -3 Query: 335 KILTRRAKHFRVEAKYVRASMWDREETFDLFIERFSSLK 219 KILTR KHF V +KYVR SM DREET++LF+ER S ++ Sbjct: 399 KILTRGGKHFGVGSKYVRISMLDREETYNLFVERLSQIR 437 >ref|XP_008464530.1| PREDICTED: tryptophan aminotransferase-related protein 2-like [Cucumis melo] Length = 442 Score = 54.3 bits (129), Expect = 9e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -3 Query: 335 KILTRRAKHFRVEAKYVRASMWDREETFDLFIERFSSL 222 KILTR KHF V +KYVR SM DREET++LFIER S + Sbjct: 399 KILTRSGKHFGVGSKYVRISMLDREETYNLFIERLSQI 436 >ref|XP_011655140.1| PREDICTED: tryptophan aminotransferase-related protein 2-like [Cucumis sativus] Length = 443 Score = 54.3 bits (129), Expect = 9e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -3 Query: 335 KILTRRAKHFRVEAKYVRASMWDREETFDLFIERFSSL 222 KILTR KHF V +KYVR SM DREET++LFIER S + Sbjct: 399 KILTRSGKHFGVGSKYVRISMLDREETYNLFIERLSEI 436