BLASTX nr result
ID: Ophiopogon23_contig00037786
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00037786 (465 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010921969.1| PREDICTED: isoleucine--tRNA ligase, cytoplas... 94 2e-19 ref|XP_010921968.1| PREDICTED: isoleucine--tRNA ligase, cytoplas... 94 2e-19 gb|ONK75972.1| uncharacterized protein A4U43_C03F22490, partial ... 93 5e-19 ref|XP_020257793.1| isoleucine--tRNA ligase, cytoplasmic [Aspara... 93 5e-19 dbj|BAD37447.1| putative isoleucine-tRNA ligase [Oryza sativa Ja... 93 6e-19 gb|EMS62671.1| Isoleucyl-tRNA synthetase, cytoplasmic [Triticum ... 93 6e-19 ref|XP_010246728.1| PREDICTED: isoleucine--tRNA ligase, cytoplas... 93 6e-19 gb|PKA47897.1| Valine--tRNA ligase [Apostasia shenzhenica] 93 6e-19 ref|XP_020179130.1| isoleucine--tRNA ligase, cytoplasmic [Aegilo... 93 6e-19 dbj|BAJ94961.1| predicted protein [Hordeum vulgare subsp. vulgare] 93 6e-19 gb|PLY91060.1| hypothetical protein LSAT_5X77240 [Lactuca sativa] 93 6e-19 ref|XP_023756282.1| isoleucine--tRNA ligase, cytoplasmic-like [L... 93 6e-19 ref|XP_009420530.1| PREDICTED: isoleucine--tRNA ligase, cytoplas... 93 6e-19 ref|XP_008776999.2| PREDICTED: LOW QUALITY PROTEIN: isoleucine--... 92 9e-19 ref|XP_012853276.1| PREDICTED: probable isoleucine--tRNA ligase,... 92 1e-18 ref|XP_023001832.1| isoleucine--tRNA ligase, cytoplasmic-like [C... 92 1e-18 ref|XP_023537189.1| isoleucine--tRNA ligase, cytoplasmic-like [C... 92 1e-18 ref|XP_022951257.1| isoleucine--tRNA ligase, cytoplasmic-like [C... 92 1e-18 ref|XP_003563308.1| PREDICTED: isoleucine--tRNA ligase, cytoplas... 92 2e-18 gb|PLY91066.1| hypothetical protein LSAT_5X76141 [Lactuca sativa] 92 2e-18 >ref|XP_010921969.1| PREDICTED: isoleucine--tRNA ligase, cytoplasmic isoform X2 [Elaeis guineensis] Length = 1185 Score = 94.4 bits (233), Expect = 2e-19 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = +3 Query: 3 MEAYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEEDSKISLSILY 149 M+AYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEED +ISLS LY Sbjct: 749 MDAYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEEDGRISLSTLY 797 >ref|XP_010921968.1| PREDICTED: isoleucine--tRNA ligase, cytoplasmic isoform X1 [Elaeis guineensis] Length = 1211 Score = 94.4 bits (233), Expect = 2e-19 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = +3 Query: 3 MEAYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEEDSKISLSILY 149 M+AYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEED +ISLS LY Sbjct: 749 MDAYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEEDGRISLSTLY 797 >gb|ONK75972.1| uncharacterized protein A4U43_C03F22490, partial [Asparagus officinalis] Length = 932 Score = 93.2 bits (230), Expect = 5e-19 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +3 Query: 3 MEAYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEEDSKISLSILY 149 MEAYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEED + SLS LY Sbjct: 597 MEAYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEEDCRTSLSTLY 645 >ref|XP_020257793.1| isoleucine--tRNA ligase, cytoplasmic [Asparagus officinalis] Length = 1037 Score = 93.2 bits (230), Expect = 5e-19 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +3 Query: 3 MEAYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEEDSKISLSILY 149 MEAYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEED + SLS LY Sbjct: 597 MEAYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEEDCRTSLSTLY 645 >dbj|BAD37447.1| putative isoleucine-tRNA ligase [Oryza sativa Japonica Group] dbj|BAS98853.1| Os06g0645400 [Oryza sativa Japonica Group] Length = 849 Score = 92.8 bits (229), Expect = 6e-19 Identities = 47/86 (54%), Positives = 59/86 (68%) Frame = +3 Query: 3 MEAYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEEDSKISLSILYXXXXXXXXXXX 182 M+AYRLYTVVPYL+K+IDNLTNIYVRFNRKRLKGRTGEED ++SLS LY Sbjct: 738 MDAYRLYTVVPYLVKYIDNLTNIYVRFNRKRLKGRTGEEDCRVSLSTLY-----HVSIYC 792 Query: 183 XLYIMVLAICVQFMRVTLVWFYILWY 260 ++ L++ MR+ + Y+ Y Sbjct: 793 AVHCFYLSLFYGLMRIKISMLYVSQY 818 >gb|EMS62671.1| Isoleucyl-tRNA synthetase, cytoplasmic [Triticum urartu] Length = 1066 Score = 92.8 bits (229), Expect = 6e-19 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = +3 Query: 3 MEAYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEEDSKISLSILY 149 M+AYRLYTVVPYL+K+IDNLTNIYVRFNRKRLKGRTGEED KISLS LY Sbjct: 658 MDAYRLYTVVPYLVKYIDNLTNIYVRFNRKRLKGRTGEEDCKISLSTLY 706 >ref|XP_010246728.1| PREDICTED: isoleucine--tRNA ligase, cytoplasmic [Nelumbo nucifera] Length = 1132 Score = 92.8 bits (229), Expect = 6e-19 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = +3 Query: 3 MEAYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEEDSKISLSILY 149 M+AYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEED K++LS LY Sbjct: 696 MDAYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEEDCKMALSTLY 744 >gb|PKA47897.1| Valine--tRNA ligase [Apostasia shenzhenica] Length = 1140 Score = 92.8 bits (229), Expect = 6e-19 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = +3 Query: 3 MEAYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEEDSKISLSILY 149 M+AYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEED ++SLS LY Sbjct: 737 MDAYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEEDCRMSLSTLY 785 >ref|XP_020179130.1| isoleucine--tRNA ligase, cytoplasmic [Aegilops tauschii subsp. tauschii] Length = 1171 Score = 92.8 bits (229), Expect = 6e-19 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = +3 Query: 3 MEAYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEEDSKISLSILY 149 M+AYRLYTVVPYL+K+IDNLTNIYVRFNRKRLKGRTGEED KISLS LY Sbjct: 738 MDAYRLYTVVPYLVKYIDNLTNIYVRFNRKRLKGRTGEEDCKISLSTLY 786 >dbj|BAJ94961.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 1172 Score = 92.8 bits (229), Expect = 6e-19 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = +3 Query: 3 MEAYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEEDSKISLSILY 149 M+AYRLYTVVPYL+K+IDNLTNIYVRFNRKRLKGRTGEED KISLS LY Sbjct: 738 MDAYRLYTVVPYLVKYIDNLTNIYVRFNRKRLKGRTGEEDCKISLSTLY 786 >gb|PLY91060.1| hypothetical protein LSAT_5X77240 [Lactuca sativa] Length = 1174 Score = 92.8 bits (229), Expect = 6e-19 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = +3 Query: 3 MEAYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEEDSKISLSILY 149 M+AYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEED +I+LS LY Sbjct: 735 MDAYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEEDCRIALSTLY 783 >ref|XP_023756282.1| isoleucine--tRNA ligase, cytoplasmic-like [Lactuca sativa] Length = 1176 Score = 92.8 bits (229), Expect = 6e-19 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = +3 Query: 3 MEAYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEEDSKISLSILY 149 M+AYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEED +I+LS LY Sbjct: 737 MDAYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEEDCRIALSTLY 785 >ref|XP_009420530.1| PREDICTED: isoleucine--tRNA ligase, cytoplasmic [Musa acuminata subsp. malaccensis] Length = 1193 Score = 92.8 bits (229), Expect = 6e-19 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = +3 Query: 3 MEAYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEEDSKISLSILY 149 M++YRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEED +ISLS LY Sbjct: 750 MDSYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEEDCRISLSTLY 798 >ref|XP_008776999.2| PREDICTED: LOW QUALITY PROTEIN: isoleucine--tRNA ligase, cytoplasmic-like [Phoenix dactylifera] Length = 1185 Score = 92.4 bits (228), Expect = 9e-19 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = +3 Query: 3 MEAYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEEDSKISLSILY 149 M+AYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEED +ISLS L+ Sbjct: 749 MDAYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEEDGRISLSTLH 797 >ref|XP_012853276.1| PREDICTED: probable isoleucine--tRNA ligase, cytoplasmic [Erythranthe guttata] Length = 1177 Score = 92.0 bits (227), Expect = 1e-18 Identities = 43/49 (87%), Positives = 47/49 (95%) Frame = +3 Query: 3 MEAYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEEDSKISLSILY 149 M+AYRLYTVVPYLLKF+DNLTNIYVRFNRKRLKGRTGE+D KI+LS LY Sbjct: 739 MDAYRLYTVVPYLLKFLDNLTNIYVRFNRKRLKGRTGEDDCKIALSTLY 787 >ref|XP_023001832.1| isoleucine--tRNA ligase, cytoplasmic-like [Cucurbita maxima] Length = 1178 Score = 92.0 bits (227), Expect = 1e-18 Identities = 43/49 (87%), Positives = 47/49 (95%) Frame = +3 Query: 3 MEAYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEEDSKISLSILY 149 M+AYRLYTVVPYLLKF+DNLTNIYVRFNRKRLKGRTGEED +I+LS LY Sbjct: 748 MDAYRLYTVVPYLLKFLDNLTNIYVRFNRKRLKGRTGEEDCRIALSTLY 796 >ref|XP_023537189.1| isoleucine--tRNA ligase, cytoplasmic-like [Cucurbita pepo subsp. pepo] Length = 1185 Score = 92.0 bits (227), Expect = 1e-18 Identities = 43/49 (87%), Positives = 47/49 (95%) Frame = +3 Query: 3 MEAYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEEDSKISLSILY 149 M+AYRLYTVVPYLLKF+DNLTNIYVRFNRKRLKGRTGEED +I+LS LY Sbjct: 748 MDAYRLYTVVPYLLKFLDNLTNIYVRFNRKRLKGRTGEEDCRIALSTLY 796 >ref|XP_022951257.1| isoleucine--tRNA ligase, cytoplasmic-like [Cucurbita moschata] Length = 1185 Score = 92.0 bits (227), Expect = 1e-18 Identities = 43/49 (87%), Positives = 47/49 (95%) Frame = +3 Query: 3 MEAYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEEDSKISLSILY 149 M+AYRLYTVVPYLLKF+DNLTNIYVRFNRKRLKGRTGEED +I+LS LY Sbjct: 748 MDAYRLYTVVPYLLKFLDNLTNIYVRFNRKRLKGRTGEEDCRIALSTLY 796 >ref|XP_003563308.1| PREDICTED: isoleucine--tRNA ligase, cytoplasmic isoform X1 [Brachypodium distachyon] ref|XP_014753004.1| PREDICTED: isoleucine--tRNA ligase, cytoplasmic isoform X2 [Brachypodium distachyon] gb|KQK16788.1| hypothetical protein BRADI_1g30610v3 [Brachypodium distachyon] Length = 1172 Score = 91.7 bits (226), Expect = 2e-18 Identities = 43/49 (87%), Positives = 47/49 (95%) Frame = +3 Query: 3 MEAYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEEDSKISLSILY 149 M+AYRLYTVVPYL+K+IDNLTNIYVRFNRKRLKGRTGEED +ISLS LY Sbjct: 738 MDAYRLYTVVPYLVKYIDNLTNIYVRFNRKRLKGRTGEEDCRISLSTLY 786 >gb|PLY91066.1| hypothetical protein LSAT_5X76141 [Lactuca sativa] Length = 1179 Score = 91.7 bits (226), Expect = 2e-18 Identities = 43/49 (87%), Positives = 47/49 (95%) Frame = +3 Query: 3 MEAYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEEDSKISLSILY 149 M++YRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEED +I+LS LY Sbjct: 741 MDSYRLYTVVPYLLKFIDNLTNIYVRFNRKRLKGRTGEEDCRIALSTLY 789