BLASTX nr result
ID: Ophiopogon23_contig00037643
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00037643 (441 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020250073.1| putative pentatricopeptide repeat-containing... 110 4e-25 ref|XP_008791051.1| PREDICTED: putative pentatricopeptide repeat... 104 4e-23 ref|XP_018859195.1| PREDICTED: putative pentatricopeptide repeat... 103 8e-23 gb|OEL33377.1| putative pentatricopeptide repeat-containing prot... 101 5e-22 ref|XP_008649272.1| putative pentatricopeptide repeat-containing... 100 7e-22 ref|XP_004971848.1| putative pentatricopeptide repeat-containing... 100 7e-22 ref|XP_020702159.1| putative pentatricopeptide repeat-containing... 100 7e-22 ref|XP_021723014.1| putative pentatricopeptide repeat-containing... 100 7e-22 gb|PIA39830.1| hypothetical protein AQUCO_02600354v1 [Aquilegia ... 100 1e-21 gb|OVA17395.1| Pentatricopeptide repeat [Macleaya cordata] 100 1e-21 ref|XP_015885117.1| PREDICTED: putative pentatricopeptide repeat... 100 1e-21 gb|EAY90606.1| hypothetical protein OsI_12205 [Oryza sativa Indi... 100 1e-21 ref|XP_015628135.1| PREDICTED: putative pentatricopeptide repeat... 100 1e-21 ref|XP_006651531.1| PREDICTED: putative pentatricopeptide repeat... 100 2e-21 gb|OQU76128.1| hypothetical protein SORBI_3010G097700 [Sorghum b... 100 2e-21 ref|XP_002436772.1| putative pentatricopeptide repeat-containing... 100 2e-21 ref|XP_019708208.1| PREDICTED: putative pentatricopeptide repeat... 100 2e-21 ref|XP_021970092.1| putative pentatricopeptide repeat-containing... 100 2e-21 gb|PHU18292.1| hypothetical protein BC332_13987 [Capsicum chinense] 93 2e-21 ref|XP_016494163.1| PREDICTED: pentatricopeptide repeat-containi... 96 3e-21 >ref|XP_020250073.1| putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Asparagus officinalis] ref|XP_020250074.1| putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Asparagus officinalis] ref|XP_020250075.1| putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Asparagus officinalis] ref|XP_020250076.1| putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Asparagus officinalis] gb|ONK55342.1| uncharacterized protein A4U43_UnF4560 [Asparagus officinalis] Length = 830 Score = 110 bits (274), Expect = 4e-25 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = +1 Query: 1 LGRPIRIIKNLRFCLDCHTAFKLISKVVRREFIVRDMNRFHHFEDGICSCNDYW 162 LGRPIRIIKNLRFCLDCH AF LISKVV R+ IVRDMNRFHHFEDG+CSCNDYW Sbjct: 777 LGRPIRIIKNLRFCLDCHAAFTLISKVVLRKIIVRDMNRFHHFEDGVCSCNDYW 830 >ref|XP_008791051.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Phoenix dactylifera] ref|XP_008791053.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Phoenix dactylifera] ref|XP_008791054.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Phoenix dactylifera] ref|XP_008791057.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Phoenix dactylifera] Length = 831 Score = 104 bits (259), Expect = 4e-23 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = +1 Query: 4 GRPIRIIKNLRFCLDCHTAFKLISKVVRREFIVRDMNRFHHFEDGICSCNDYW 162 G PIRIIKNLRFC DCH+AFK+ISKVV+RE IVRDMNRFHHF DGICSC+DYW Sbjct: 779 GSPIRIIKNLRFCSDCHSAFKIISKVVQREIIVRDMNRFHHFVDGICSCDDYW 831 >ref|XP_018859195.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Juglans regia] ref|XP_018859196.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Juglans regia] ref|XP_018859197.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Juglans regia] Length = 834 Score = 103 bits (257), Expect = 8e-23 Identities = 44/53 (83%), Positives = 48/53 (90%) Frame = +1 Query: 4 GRPIRIIKNLRFCLDCHTAFKLISKVVRREFIVRDMNRFHHFEDGICSCNDYW 162 GRPIRIIKNLR C+DCH A KLISKVV+R+ IVRDMNRFHHF+DGICSC DYW Sbjct: 782 GRPIRIIKNLRICVDCHAAMKLISKVVQRDIIVRDMNRFHHFQDGICSCGDYW 834 >gb|OEL33377.1| putative pentatricopeptide repeat-containing protein [Dichanthelium oligosanthes] Length = 751 Score = 101 bits (251), Expect = 5e-22 Identities = 42/53 (79%), Positives = 48/53 (90%) Frame = +1 Query: 4 GRPIRIIKNLRFCLDCHTAFKLISKVVRREFIVRDMNRFHHFEDGICSCNDYW 162 G PIRI+KNLR CLDCHT FK+ISK+V+RE IVRD+NRFHHFE+GICSC DYW Sbjct: 699 GHPIRIMKNLRSCLDCHTVFKVISKIVQREIIVRDINRFHHFEEGICSCGDYW 751 >ref|XP_008649272.1| putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Zea mays] ref|XP_020395055.1| putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Zea mays] gb|AQK83425.1| Putative pentatricopeptide repeat family protein [Zea mays] Length = 823 Score = 100 bits (250), Expect = 7e-22 Identities = 42/53 (79%), Positives = 48/53 (90%) Frame = +1 Query: 4 GRPIRIIKNLRFCLDCHTAFKLISKVVRREFIVRDMNRFHHFEDGICSCNDYW 162 G PIRI+KNLR CLDCHT FK+ISK+V+RE IVRD+NRFHHFE+GICSC DYW Sbjct: 771 GHPIRIMKNLRSCLDCHTMFKVISKIVQREIIVRDINRFHHFEEGICSCGDYW 823 >ref|XP_004971848.1| putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial isoform X1 [Setaria italica] gb|KQL05267.1| hypothetical protein SETIT_000316mg [Setaria italica] Length = 825 Score = 100 bits (250), Expect = 7e-22 Identities = 41/53 (77%), Positives = 48/53 (90%) Frame = +1 Query: 4 GRPIRIIKNLRFCLDCHTAFKLISKVVRREFIVRDMNRFHHFEDGICSCNDYW 162 G PIR++KNLR CLDCHT FK+ISK+V+RE IVRD+NRFHHFE+GICSC DYW Sbjct: 773 GHPIRVMKNLRSCLDCHTVFKVISKIVQREIIVRDINRFHHFEEGICSCGDYW 825 >ref|XP_020702159.1| putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Dendrobium catenatum] gb|PKU70376.1| Putative pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 830 Score = 100 bits (250), Expect = 7e-22 Identities = 44/53 (83%), Positives = 47/53 (88%) Frame = +1 Query: 4 GRPIRIIKNLRFCLDCHTAFKLISKVVRREFIVRDMNRFHHFEDGICSCNDYW 162 G PIRIIKNLRFC DCH +FKLISKVV RE IVRDMNRFHHFE+GICSC D+W Sbjct: 778 GSPIRIIKNLRFCSDCHASFKLISKVVGRELIVRDMNRFHHFEEGICSCADFW 830 >ref|XP_021723014.1| putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Chenopodium quinoa] ref|XP_021723015.1| putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Chenopodium quinoa] Length = 836 Score = 100 bits (250), Expect = 7e-22 Identities = 42/54 (77%), Positives = 47/54 (87%) Frame = +1 Query: 1 LGRPIRIIKNLRFCLDCHTAFKLISKVVRREFIVRDMNRFHHFEDGICSCNDYW 162 LG P+RI+KNLR C DCH A KLISKVV+RE +VRD+NRFHHFEDGICSC DYW Sbjct: 783 LGSPVRILKNLRICADCHAAVKLISKVVQREIVVRDINRFHHFEDGICSCGDYW 836 >gb|PIA39830.1| hypothetical protein AQUCO_02600354v1 [Aquilegia coerulea] Length = 715 Score = 100 bits (249), Expect = 1e-21 Identities = 41/53 (77%), Positives = 47/53 (88%) Frame = +1 Query: 4 GRPIRIIKNLRFCLDCHTAFKLISKVVRREFIVRDMNRFHHFEDGICSCNDYW 162 GRP+RIIKNLR CLDCH A KLIS+V +RE +VRDMNRFHHFE+G+CSC DYW Sbjct: 663 GRPVRIIKNLRICLDCHAAIKLISQVCQREIVVRDMNRFHHFENGVCSCGDYW 715 >gb|OVA17395.1| Pentatricopeptide repeat [Macleaya cordata] Length = 832 Score = 100 bits (249), Expect = 1e-21 Identities = 43/53 (81%), Positives = 46/53 (86%) Frame = +1 Query: 4 GRPIRIIKNLRFCLDCHTAFKLISKVVRREFIVRDMNRFHHFEDGICSCNDYW 162 G PIRIIKNLR C DCH A KLISKVV+RE +VRDMNRFHHFE+GICSC DYW Sbjct: 780 GSPIRIIKNLRICADCHAAIKLISKVVQREIVVRDMNRFHHFENGICSCGDYW 832 >ref|XP_015885117.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Ziziphus jujuba] Length = 833 Score = 100 bits (249), Expect = 1e-21 Identities = 40/53 (75%), Positives = 48/53 (90%) Frame = +1 Query: 4 GRPIRIIKNLRFCLDCHTAFKLISKVVRREFIVRDMNRFHHFEDGICSCNDYW 162 G PIRIIKNLR C+DCH A KLISKVV+R+ +VRD+NRFHHF+DG+CSC+DYW Sbjct: 781 GSPIRIIKNLRICIDCHAAMKLISKVVKRDIVVRDLNRFHHFQDGVCSCSDYW 833 >gb|EAY90606.1| hypothetical protein OsI_12205 [Oryza sativa Indica Group] Length = 818 Score = 100 bits (248), Expect = 1e-21 Identities = 42/53 (79%), Positives = 47/53 (88%) Frame = +1 Query: 4 GRPIRIIKNLRFCLDCHTAFKLISKVVRREFIVRDMNRFHHFEDGICSCNDYW 162 G PIRI+KNLR CLDCHTAF +ISK+V+RE IVRD+NRFHHFEDG CSC DYW Sbjct: 766 GHPIRILKNLRSCLDCHTAFTVISKIVKREIIVRDINRFHHFEDGKCSCGDYW 818 >ref|XP_015628135.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Oryza sativa Japonica Group] ref|XP_015628136.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Oryza sativa Japonica Group] gb|ABF96852.1| pentatricopeptide, putative, expressed [Oryza sativa Japonica Group] dbj|BAF12374.1| Os03g0441400 [Oryza sativa Japonica Group] dbj|BAG99607.1| unnamed protein product [Oryza sativa Japonica Group] dbj|BAS84882.1| Os03g0441400 [Oryza sativa Japonica Group] Length = 837 Score = 100 bits (248), Expect = 1e-21 Identities = 42/53 (79%), Positives = 47/53 (88%) Frame = +1 Query: 4 GRPIRIIKNLRFCLDCHTAFKLISKVVRREFIVRDMNRFHHFEDGICSCNDYW 162 G PIRI+KNLR CLDCHTAF +ISK+V+RE IVRD+NRFHHFEDG CSC DYW Sbjct: 785 GHPIRILKNLRSCLDCHTAFTVISKIVKREIIVRDINRFHHFEDGKCSCGDYW 837 >ref|XP_006651531.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Oryza brachyantha] Length = 815 Score = 99.8 bits (247), Expect = 2e-21 Identities = 42/53 (79%), Positives = 47/53 (88%) Frame = +1 Query: 4 GRPIRIIKNLRFCLDCHTAFKLISKVVRREFIVRDMNRFHHFEDGICSCNDYW 162 G PIRI+KNLR CLDCHTAF LISK+V+RE IVRD+NRFHHFE+G CSC DYW Sbjct: 763 GHPIRILKNLRSCLDCHTAFTLISKIVKREIIVRDINRFHHFEEGKCSCGDYW 815 >gb|OQU76128.1| hypothetical protein SORBI_3010G097700 [Sorghum bicolor] Length = 823 Score = 99.8 bits (247), Expect = 2e-21 Identities = 40/53 (75%), Positives = 48/53 (90%) Frame = +1 Query: 4 GRPIRIIKNLRFCLDCHTAFKLISKVVRREFIVRDMNRFHHFEDGICSCNDYW 162 G PIRI+KNLR CLDCHT FK+ISK+V+RE +VRD+NRFHHF++GICSC DYW Sbjct: 771 GHPIRIMKNLRSCLDCHTVFKVISKIVQREIVVRDINRFHHFDEGICSCGDYW 823 >ref|XP_002436772.1| putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Sorghum bicolor] Length = 825 Score = 99.8 bits (247), Expect = 2e-21 Identities = 40/53 (75%), Positives = 48/53 (90%) Frame = +1 Query: 4 GRPIRIIKNLRFCLDCHTAFKLISKVVRREFIVRDMNRFHHFEDGICSCNDYW 162 G PIRI+KNLR CLDCHT FK+ISK+V+RE +VRD+NRFHHF++GICSC DYW Sbjct: 773 GHPIRIMKNLRSCLDCHTVFKVISKIVQREIVVRDINRFHHFDEGICSCGDYW 825 >ref|XP_019708208.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Elaeis guineensis] ref|XP_010929651.2| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Elaeis guineensis] ref|XP_019708209.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Elaeis guineensis] ref|XP_019708210.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Elaeis guineensis] ref|XP_019708211.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Elaeis guineensis] Length = 831 Score = 99.8 bits (247), Expect = 2e-21 Identities = 43/53 (81%), Positives = 47/53 (88%) Frame = +1 Query: 4 GRPIRIIKNLRFCLDCHTAFKLISKVVRREFIVRDMNRFHHFEDGICSCNDYW 162 G PIRIIKNLRFC DCH AFK+ISKVV+RE IVRDMNRFHH +GICSC+DYW Sbjct: 779 GSPIRIIKNLRFCSDCHAAFKIISKVVQREIIVRDMNRFHHLVNGICSCDDYW 831 >ref|XP_021970092.1| putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Helianthus annuus] gb|OTG22762.1| putative tetratricopeptide repeat (TPR)-like superfamily protein [Helianthus annuus] Length = 832 Score = 99.8 bits (247), Expect = 2e-21 Identities = 40/53 (75%), Positives = 46/53 (86%) Frame = +1 Query: 4 GRPIRIIKNLRFCLDCHTAFKLISKVVRREFIVRDMNRFHHFEDGICSCNDYW 162 G PIRI+KNLR CLDCH FK ISK+V+RE +VRD+NRFHHFEDG+CSC DYW Sbjct: 780 GCPIRIMKNLRICLDCHVVFKFISKIVKREIVVRDINRFHHFEDGVCSCGDYW 832 >gb|PHU18292.1| hypothetical protein BC332_13987 [Capsicum chinense] Length = 144 Score = 93.2 bits (230), Expect = 2e-21 Identities = 39/53 (73%), Positives = 44/53 (83%) Frame = +1 Query: 4 GRPIRIIKNLRFCLDCHTAFKLISKVVRREFIVRDMNRFHHFEDGICSCNDYW 162 G PIR+ KNLR CLDCHTAFKLI K+V RE I+RD+N FHHF+DG CSC DYW Sbjct: 92 GVPIRVKKNLRICLDCHTAFKLICKIVSREIIIRDINWFHHFKDGSCSCGDYW 144 >ref|XP_016494163.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Nicotiana tabacum] ref|XP_016494164.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Nicotiana tabacum] ref|XP_016494165.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Nicotiana tabacum] ref|XP_016494166.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Nicotiana tabacum] Length = 246 Score = 95.5 bits (236), Expect = 3e-21 Identities = 39/53 (73%), Positives = 44/53 (83%) Frame = +1 Query: 4 GRPIRIIKNLRFCLDCHTAFKLISKVVRREFIVRDMNRFHHFEDGICSCNDYW 162 G PIR+ KNLR CLDCHTAFK I K+V RE I+RD+NRFHHF+DG CSC DYW Sbjct: 194 GAPIRVKKNLRICLDCHTAFKFICKIVSREIIIRDINRFHHFKDGSCSCGDYW 246