BLASTX nr result
ID: Ophiopogon23_contig00037467
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00037467 (721 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020265530.1| centromere/kinetochore protein zw10 homolog ... 58 4e-06 >ref|XP_020265530.1| centromere/kinetochore protein zw10 homolog [Asparagus officinalis] gb|ONK70268.1| uncharacterized protein A4U43_C05F31980 [Asparagus officinalis] Length = 734 Score = 58.2 bits (139), Expect = 4e-06 Identities = 30/49 (61%), Positives = 36/49 (73%) Frame = +2 Query: 263 KSKVRSYVLSHRHDFTAIFSLVAASDDSYAVLTDTIASTFCLLEARPLD 409 KS+VRSYVLSHR DF +IFSL A+S S A L+D++A LL RPLD Sbjct: 21 KSRVRSYVLSHRDDFASIFSLSASSSASVASLSDSLADALRLLSDRPLD 69