BLASTX nr result
ID: Ophiopogon23_contig00037387
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00037387 (465 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_018327517.1| PREDICTED: ion transport peptide-like isofor... 54 5e-06 >ref|XP_018327517.1| PREDICTED: ion transport peptide-like isoform X2 [Agrilus planipennis] Length = 137 Score = 53.5 bits (127), Expect = 5e-06 Identities = 29/77 (37%), Positives = 43/77 (55%) Frame = +3 Query: 123 DHKCKNLGDKNVEKYDVLHTVCVACYNRLGQIDENYDKCSSNCFLTNEFNVCVNGLYLSN 302 D +CK + DK++ + L +C CYN L + E + C NCF T+ F C++ L L + Sbjct: 62 DIECKGVYDKSI--FARLDRICEDCYN-LFREPELHSLCRRNCFTTDYFKGCLDVLQLQD 118 Query: 303 ELPHFNRVIKELSGVEP 353 E+ F +IK L G EP Sbjct: 119 EMEQFQLMIKHLHGAEP 135