BLASTX nr result
ID: Ophiopogon23_contig00037050
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00037050 (884 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAY39020.1| hypothetical protein CUMW_041190 [Citrus unshiu] 45 5e-08 >dbj|GAY39020.1| hypothetical protein CUMW_041190 [Citrus unshiu] Length = 581 Score = 45.1 bits (105), Expect(2) = 5e-08 Identities = 22/32 (68%), Positives = 25/32 (78%) Frame = -3 Query: 354 VCLPRIVDDRNLRVADFAQFWAIAKVYSYSLF 259 VCL +VDDRNLRVADFAQFWA AK Y ++ Sbjct: 303 VCLV-LVDDRNLRVADFAQFWATAKRSGYEVY 333 Score = 41.2 bits (95), Expect(2) = 5e-08 Identities = 19/33 (57%), Positives = 19/33 (57%) Frame = -1 Query: 437 CSAYAVCTVFIFTND*CSIVWQLTHLCWYVCLV 339 C C IFTN CS V QLT CWYVCLV Sbjct: 274 CLLMCPCAACIFTNYRCSFVRQLTLSCWYVCLV 306