BLASTX nr result
ID: Ophiopogon23_contig00036946
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00036946 (442 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK62690.1| uncharacterized protein A4U43_C07F6950 [Asparagus... 59 3e-08 ref|XP_023729533.1| RNA pseudouridine synthase 5 [Lactuca sativa... 60 1e-07 ref|XP_020680583.1| RNA pseudouridine synthase 5 isoform X2 [Den... 60 1e-07 ref|XP_020680582.1| RNA pseudouridine synthase 5 isoform X1 [Den... 60 1e-07 ref|XP_020273782.1| RNA pseudouridine synthase 5 [Asparagus offi... 59 2e-07 ref|XP_021977004.1| RNA pseudouridine synthase 5 [Helianthus ann... 59 3e-07 gb|KVI04994.1| Pseudouridine synthase, catalytic domain-containi... 59 3e-07 gb|ALN96998.1| pseudouridine synthase family protein [Populus to... 57 3e-07 ref|XP_020578146.1| RNA pseudouridine synthase 5 isoform X1 [Pha... 58 5e-07 gb|PKU76855.1| RNA pseudouridine synthase 5 [Dendrobium catenatum] 57 6e-07 ref|XP_018828688.1| PREDICTED: RNA pseudouridine synthase 5 isof... 57 9e-07 gb|PNT22642.1| hypothetical protein POPTR_008G042000v3 [Populus ... 57 1e-06 gb|PNT22639.1| hypothetical protein POPTR_008G042000v3 [Populus ... 57 1e-06 ref|XP_002312025.1| hypothetical protein POPTR_0008s04160g [Popu... 57 1e-06 gb|PKI43252.1| hypothetical protein CRG98_036338, partial [Punic... 53 1e-06 ref|XP_011031776.1| PREDICTED: RNA pseudouridine synthase 5 isof... 57 2e-06 ref|XP_011031774.1| PREDICTED: RNA pseudouridine synthase 5 isof... 57 2e-06 ref|XP_011031773.1| PREDICTED: RNA pseudouridine synthase 5 isof... 57 2e-06 gb|ONL96876.1| RNA pseudouridine synthase 5 [Zea mays] 54 3e-06 gb|OVA10176.1| Pseudouridine synthase [Macleaya cordata] 56 3e-06 >gb|ONK62690.1| uncharacterized protein A4U43_C07F6950 [Asparagus officinalis] Length = 143 Score = 59.3 bits (142), Expect = 3e-08 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -2 Query: 84 GYQMPARPVPGDCGYYLHAHQLICCHPS 1 GYQ P RPVPGDCGY+LHAH+LI CHPS Sbjct: 90 GYQKPVRPVPGDCGYHLHAHRLIFCHPS 117 >ref|XP_023729533.1| RNA pseudouridine synthase 5 [Lactuca sativa] gb|PLY77160.1| hypothetical protein LSAT_8X20021 [Lactuca sativa] Length = 373 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -2 Query: 84 GYQMPARPVPGDCGYYLHAHQLICCHP 4 GY+ PA PVPGDCGYYLHAHQLI CHP Sbjct: 319 GYKKPANPVPGDCGYYLHAHQLILCHP 345 >ref|XP_020680583.1| RNA pseudouridine synthase 5 isoform X2 [Dendrobium catenatum] Length = 373 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = -2 Query: 84 GYQMPARPVPGDCGYYLHAHQLICCHPS 1 GYQ P RP+PGDCGYYLHAH+L+ CHPS Sbjct: 309 GYQKPERPLPGDCGYYLHAHRLVLCHPS 336 >ref|XP_020680582.1| RNA pseudouridine synthase 5 isoform X1 [Dendrobium catenatum] Length = 398 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = -2 Query: 84 GYQMPARPVPGDCGYYLHAHQLICCHPS 1 GYQ P RP+PGDCGYYLHAH+L+ CHPS Sbjct: 334 GYQKPERPLPGDCGYYLHAHRLVLCHPS 361 >ref|XP_020273782.1| RNA pseudouridine synthase 5 [Asparagus officinalis] Length = 386 Score = 59.3 bits (142), Expect = 2e-07 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -2 Query: 84 GYQMPARPVPGDCGYYLHAHQLICCHPS 1 GYQ P RPVPGDCGY+LHAH+LI CHPS Sbjct: 333 GYQKPVRPVPGDCGYHLHAHRLIFCHPS 360 >ref|XP_021977004.1| RNA pseudouridine synthase 5 [Helianthus annuus] ref|XP_021977005.1| RNA pseudouridine synthase 5 [Helianthus annuus] ref|XP_021977006.1| RNA pseudouridine synthase 5 [Helianthus annuus] ref|XP_021977007.1| RNA pseudouridine synthase 5 [Helianthus annuus] gb|OTG18117.1| putative pseudouridine synthase family protein [Helianthus annuus] Length = 369 Score = 58.9 bits (141), Expect = 3e-07 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = -2 Query: 84 GYQMPARPVPGDCGYYLHAHQLICCHP 4 GY PA PVPGDCGYYLHAHQL+ CHP Sbjct: 320 GYHRPANPVPGDCGYYLHAHQLVLCHP 346 >gb|KVI04994.1| Pseudouridine synthase, catalytic domain-containing protein [Cynara cardunculus var. scolymus] Length = 387 Score = 58.9 bits (141), Expect = 3e-07 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = -2 Query: 84 GYQMPARPVPGDCGYYLHAHQLICCHP 4 GY PA PVPGDCGYYLHAHQL+ CHP Sbjct: 342 GYHRPANPVPGDCGYYLHAHQLVLCHP 368 >gb|ALN96998.1| pseudouridine synthase family protein [Populus tomentosa] Length = 170 Score = 57.0 bits (136), Expect = 3e-07 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -2 Query: 84 GYQMPARPVPGDCGYYLHAHQLICCHPS 1 GY+ PA+PVPGDCGYYLHAHQL+ HP+ Sbjct: 118 GYERPAKPVPGDCGYYLHAHQLVLSHPT 145 >ref|XP_020578146.1| RNA pseudouridine synthase 5 isoform X1 [Phalaenopsis equestris] Length = 403 Score = 58.2 bits (139), Expect = 5e-07 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = -2 Query: 108 KRSI*IPRGYQMPARPVPGDCGYYLHAHQLICCHPS 1 K SI GYQ PARPVPGDCGYYLHAH L+ HPS Sbjct: 330 KYSIPEDGGYQRPARPVPGDCGYYLHAHMLVLRHPS 365 >gb|PKU76855.1| RNA pseudouridine synthase 5 [Dendrobium catenatum] Length = 191 Score = 56.6 bits (135), Expect = 6e-07 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = -2 Query: 84 GYQMPARPVPGDCGYYLHAHQLICCHPS 1 GYQ P RP+PGDCGYYLHA +L+ CHPS Sbjct: 127 GYQKPERPLPGDCGYYLHARRLVLCHPS 154 >ref|XP_018828688.1| PREDICTED: RNA pseudouridine synthase 5 isoform X1 [Juglans regia] ref|XP_018828689.1| PREDICTED: RNA pseudouridine synthase 5 isoform X1 [Juglans regia] ref|XP_018828690.1| PREDICTED: RNA pseudouridine synthase 5 isoform X1 [Juglans regia] ref|XP_018828691.1| PREDICTED: RNA pseudouridine synthase 5 isoform X1 [Juglans regia] Length = 384 Score = 57.4 bits (137), Expect = 9e-07 Identities = 21/29 (72%), Positives = 25/29 (86%) Frame = -2 Query: 87 RGYQMPARPVPGDCGYYLHAHQLICCHPS 1 RGYQ P +PVPGDCGYYLHAHQ++ HP+ Sbjct: 329 RGYQRPTKPVPGDCGYYLHAHQVVLSHPT 357 >gb|PNT22642.1| hypothetical protein POPTR_008G042000v3 [Populus trichocarpa] Length = 358 Score = 57.0 bits (136), Expect = 1e-06 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -2 Query: 84 GYQMPARPVPGDCGYYLHAHQLICCHPS 1 GY+ PA+PVPGDCGYYLHAHQL+ HP+ Sbjct: 324 GYERPAKPVPGDCGYYLHAHQLVLSHPT 351 >gb|PNT22639.1| hypothetical protein POPTR_008G042000v3 [Populus trichocarpa] Length = 376 Score = 57.0 bits (136), Expect = 1e-06 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -2 Query: 84 GYQMPARPVPGDCGYYLHAHQLICCHPS 1 GY+ PA+PVPGDCGYYLHAHQL+ HP+ Sbjct: 324 GYERPAKPVPGDCGYYLHAHQLVLSHPT 351 >ref|XP_002312025.1| hypothetical protein POPTR_0008s04160g [Populus trichocarpa] gb|PNT22640.1| hypothetical protein POPTR_008G042000v3 [Populus trichocarpa] Length = 377 Score = 57.0 bits (136), Expect = 1e-06 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -2 Query: 84 GYQMPARPVPGDCGYYLHAHQLICCHPS 1 GY+ PA+PVPGDCGYYLHAHQL+ HP+ Sbjct: 324 GYERPAKPVPGDCGYYLHAHQLVLSHPT 351 >gb|PKI43252.1| hypothetical protein CRG98_036338, partial [Punica granatum] Length = 59 Score = 52.8 bits (125), Expect = 1e-06 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = -2 Query: 84 GYQMPARPVPGDCGYYLHAHQLICCHP 4 GYQ P PVPGDCGY+LHAHQL+ HP Sbjct: 1 GYQRPENPVPGDCGYFLHAHQLVLHHP 27 >ref|XP_011031776.1| PREDICTED: RNA pseudouridine synthase 5 isoform X4 [Populus euphratica] Length = 314 Score = 56.6 bits (135), Expect = 2e-06 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = -2 Query: 84 GYQMPARPVPGDCGYYLHAHQLICCHP 4 GY+ PA+PVPGDCGYYLHAHQL+ HP Sbjct: 259 GYERPAKPVPGDCGYYLHAHQLVLSHP 285 >ref|XP_011031774.1| PREDICTED: RNA pseudouridine synthase 5 isoform X2 [Populus euphratica] Length = 378 Score = 56.6 bits (135), Expect = 2e-06 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = -2 Query: 84 GYQMPARPVPGDCGYYLHAHQLICCHP 4 GY+ PA+PVPGDCGYYLHAHQL+ HP Sbjct: 324 GYERPAKPVPGDCGYYLHAHQLVLSHP 350 >ref|XP_011031773.1| PREDICTED: RNA pseudouridine synthase 5 isoform X1 [Populus euphratica] Length = 379 Score = 56.6 bits (135), Expect = 2e-06 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = -2 Query: 84 GYQMPARPVPGDCGYYLHAHQLICCHP 4 GY+ PA+PVPGDCGYYLHAHQL+ HP Sbjct: 324 GYERPAKPVPGDCGYYLHAHQLVLSHP 350 >gb|ONL96876.1| RNA pseudouridine synthase 5 [Zea mays] Length = 139 Score = 53.9 bits (128), Expect = 3e-06 Identities = 19/28 (67%), Positives = 24/28 (85%) Frame = -2 Query: 84 GYQMPARPVPGDCGYYLHAHQLICCHPS 1 GY+ P +PVPGDCGY+LHAH L+ CHP+ Sbjct: 72 GYERPLQPVPGDCGYHLHAHWLVLCHPT 99 >gb|OVA10176.1| Pseudouridine synthase [Macleaya cordata] Length = 362 Score = 55.8 bits (133), Expect = 3e-06 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = -2 Query: 84 GYQMPARPVPGDCGYYLHAHQLICCHPS 1 GYQ P +PVPGDCGYYLHAHQL+ HP+ Sbjct: 330 GYQRPRKPVPGDCGYYLHAHQLVLYHPT 357