BLASTX nr result
ID: Ophiopogon23_contig00036910
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00036910 (442 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020253590.1| F-box protein SKIP24 isoform X5 [Asparagus o... 59 2e-07 ref|XP_020253589.1| F-box protein SKIP24 isoform X4 [Asparagus o... 59 2e-07 ref|XP_020253588.1| F-box protein SKIP24 isoform X3 [Asparagus o... 59 2e-07 ref|XP_020253586.1| F-box protein SKIP24 isoform X2 [Asparagus o... 59 2e-07 ref|XP_020253585.1| F-box protein SKIP24 isoform X1 [Asparagus o... 59 2e-07 >ref|XP_020253590.1| F-box protein SKIP24 isoform X5 [Asparagus officinalis] Length = 242 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 331 MSFLPDEMWARILELGTSSAQLSYLDLCSVSAASRR 438 MS LPDE+W RI+ELGTSS+QLSY DLCS+S + RR Sbjct: 1 MSILPDELWTRIMELGTSSSQLSYRDLCSISISCRR 36 >ref|XP_020253589.1| F-box protein SKIP24 isoform X4 [Asparagus officinalis] gb|ONK77932.1| uncharacterized protein A4U43_C02F12450 [Asparagus officinalis] Length = 244 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 331 MSFLPDEMWARILELGTSSAQLSYLDLCSVSAASRR 438 MS LPDE+W RI+ELGTSS+QLSY DLCS+S + RR Sbjct: 1 MSILPDELWTRIMELGTSSSQLSYRDLCSISISCRR 36 >ref|XP_020253588.1| F-box protein SKIP24 isoform X3 [Asparagus officinalis] Length = 253 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 331 MSFLPDEMWARILELGTSSAQLSYLDLCSVSAASRR 438 MS LPDE+W RI+ELGTSS+QLSY DLCS+S + RR Sbjct: 1 MSILPDELWTRIMELGTSSSQLSYRDLCSISISCRR 36 >ref|XP_020253586.1| F-box protein SKIP24 isoform X2 [Asparagus officinalis] Length = 259 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 331 MSFLPDEMWARILELGTSSAQLSYLDLCSVSAASRR 438 MS LPDE+W RI+ELGTSS+QLSY DLCS+S + RR Sbjct: 1 MSILPDELWTRIMELGTSSSQLSYRDLCSISISCRR 36 >ref|XP_020253585.1| F-box protein SKIP24 isoform X1 [Asparagus officinalis] Length = 260 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 331 MSFLPDEMWARILELGTSSAQLSYLDLCSVSAASRR 438 MS LPDE+W RI+ELGTSS+QLSY DLCS+S + RR Sbjct: 1 MSILPDELWTRIMELGTSSSQLSYRDLCSISISCRR 36