BLASTX nr result
ID: Ophiopogon23_contig00036786
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00036786 (394 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK65328.1| uncharacterized protein A4U43_C07F35990 [Asparagu... 56 1e-06 >gb|ONK65328.1| uncharacterized protein A4U43_C07F35990 [Asparagus officinalis] Length = 257 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/54 (46%), Positives = 35/54 (64%) Frame = -2 Query: 243 MAQLTRPASPIPVSLSSLGAHFSAVIVITLVFVWAIHFRGGFALHSDNVDLILN 82 MA + RP + + S +S+ AH A++ LV VWAIH+ GG +LHSDN L+ N Sbjct: 1 MAIIARPMALVAASYASVAAHLFALLAAILVLVWAIHYGGGLSLHSDNEALVFN 54