BLASTX nr result
ID: Ophiopogon23_contig00036582
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00036582 (427 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK60974.1| uncharacterized protein A4U43_C08F24680 [Asparagu... 62 2e-08 >gb|ONK60974.1| uncharacterized protein A4U43_C08F24680 [Asparagus officinalis] Length = 521 Score = 62.0 bits (149), Expect = 2e-08 Identities = 32/76 (42%), Positives = 44/76 (57%), Gaps = 3/76 (3%) Frame = +3 Query: 171 FAQAVRG---PGFVRAHAESVSSFGIVPDVAIFPQADSREGFPALILSEQEVSSAESLLE 341 +AQA +G PGFVRAHA V SF +P I SR+GFP + + ++ E L Sbjct: 298 YAQAAKGTPGPGFVRAHARDVESFARLPRTGINVIRGSRDGFPTFSIVQSDMPKVEGLYA 357 Query: 342 RAVIVKFLSGRPKLEE 389 +A+++KF GRP L E Sbjct: 358 KALVMKFHGGRPSLAE 373