BLASTX nr result
ID: Ophiopogon23_contig00036535
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00036535 (673 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009315961.1| hypothetical protein (mitochondrion) [Cocos ... 65 1e-10 >ref|YP_009315961.1| hypothetical protein (mitochondrion) [Cocos nucifera] gb|AOX12955.1| hypothetical protein (mitochondrion) [Cocos nucifera] Length = 68 Score = 65.5 bits (158), Expect = 1e-10 Identities = 35/48 (72%), Positives = 38/48 (79%) Frame = -1 Query: 217 GKEKRAGKRLFFLSYHVISRRARLCMRLVLRSKSGSPFHSLKILSIKE 74 G EK+ G+ F SYH+ RARLCMRLVLRSKSGSPFHSLKILS KE Sbjct: 16 GAEKKRGRPGPFSSYHIT--RARLCMRLVLRSKSGSPFHSLKILSTKE 61 Score = 59.3 bits (142), Expect = 2e-08 Identities = 28/33 (84%), Positives = 28/33 (84%) Frame = -2 Query: 267 MLYQLSYTPDLTIRVGAEKKRGLESAFSSYHIT 169 MLYQLSYTPD TIRVGAEKKRG FSSYHIT Sbjct: 1 MLYQLSYTPDFTIRVGAEKKRGRPGPFSSYHIT 33