BLASTX nr result
ID: Ophiopogon23_contig00036402
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00036402 (416 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020240861.1| scarecrow-like protein 6 [Asparagus officina... 58 6e-07 >ref|XP_020240861.1| scarecrow-like protein 6 [Asparagus officinalis] Length = 600 Score = 57.8 bits (138), Expect = 6e-07 Identities = 29/43 (67%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = +3 Query: 165 MPCTEFQSQGVLQQESTANFWSNKKRKGVTSI-EPTSVLDKRR 290 MP T+ QSQGV + E A+FWSNKKRK V + EPTSVLDKRR Sbjct: 1 MPFTQIQSQGVEEHEIRADFWSNKKRKAVAGLREPTSVLDKRR 43